BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D18 (887 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55280.1 68416.m06139 60S ribosomal protein L23A (RPL23aB) va... 40 0.002 At2g39460.1 68415.m04843 60S ribosomal protein L23A (RPL23aA) id... 37 0.021 >At3g55280.1 68416.m06139 60S ribosomal protein L23A (RPL23aB) various ribosomal L23a proteins Length = 154 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/46 (47%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +2 Query: 710 PVTKALKAQRKVVXGXHGKR-VRKIXXSVHFRRPKTFEPPXHPKYP 844 P KALKA + V G K+ +KI V F RPKT P PKYP Sbjct: 14 PKAKALKAAKAVKSGQIVKKPAKKIRTKVTFHRPKTLTVPRKPKYP 59 >At2g39460.1 68415.m04843 60S ribosomal protein L23A (RPL23aA) identical to GB:AF034694 Length = 154 Score = 36.7 bits (81), Expect = 0.021 Identities = 21/46 (45%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 710 PVTKALKAQRKVVXGX-HGKRVRKIXXSVHFRRPKTFEPPXHPKYP 844 P KALKA + V G K+ +KI V F RPKT P KYP Sbjct: 14 PKAKALKAAKAVKSGQAFKKKDKKIRTKVTFHRPKTLTKPRTGKYP 59 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,735,294 Number of Sequences: 28952 Number of extensions: 110538 Number of successful extensions: 217 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 217 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2081245872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -