BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D16 (901 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 29 0.19 DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. 26 1.4 DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 26 1.8 AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha su... 26 1.8 AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha su... 26 1.8 AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha su... 25 2.4 AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha su... 25 2.4 AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha su... 25 2.4 CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 25 4.1 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 24 5.5 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 7.2 DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide... 24 7.2 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 7.2 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 7.2 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 24 7.2 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 29.1 bits (62), Expect = 0.19 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = +2 Query: 41 RFWPFS---CGRVTAWFTVAFLKETYKMAIRPVYRPTIVKKRTKRFI 172 RF+ FS C ++ WF VAF E + + P+ R T+ R + + Sbjct: 193 RFFTFSSSLCCFLSVWFVVAFTVERFIAVLYPLKRQTMCTVRRAKIV 239 >DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. Length = 75 Score = 26.2 bits (55), Expect = 1.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 630 YIDEFGQTTTRMQ*KKCFICEIXDAIALFVT 722 ++D GQ T R + KCF C + + L T Sbjct: 13 FVDVGGQRTQRQKWTKCFDCSVTSILFLVST 43 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 25.8 bits (54), Expect = 1.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 121 YSHLVCFFKKRDSEPRGDTAARE 53 YSHLV +F + D R AARE Sbjct: 279 YSHLVDYFPEYDGPQRDAIAARE 301 >AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha subunit AgGq3 protein. Length = 162 Score = 25.8 bits (54), Expect = 1.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 121 YSHLVCFFKKRDSEPRGDTAARE 53 YSHLV +F + D R AARE Sbjct: 92 YSHLVDYFPEYDGPQRDAIAARE 114 >AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha subunit AgGq2 protein. Length = 163 Score = 25.8 bits (54), Expect = 1.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 121 YSHLVCFFKKRDSEPRGDTAARE 53 YSHLV +F + D R AARE Sbjct: 93 YSHLVDYFPEYDGPQRDAIAARE 115 >AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha subunit AgGq6 protein. Length = 206 Score = 25.4 bits (53), Expect = 2.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 121 YSHLVCFFKKRDSEPRGDTAARE 53 YSHLV +F + D D ARE Sbjct: 136 YSHLVDYFPEYDGPKHDDVKARE 158 >AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha subunit AgGq4 protein. Length = 163 Score = 25.4 bits (53), Expect = 2.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 121 YSHLVCFFKKRDSEPRGDTAARE 53 YSHLV +F + D D ARE Sbjct: 93 YSHLVDYFPEYDGPKHDDVKARE 115 >AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha subunit AgGq1 protein. Length = 162 Score = 25.4 bits (53), Expect = 2.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 121 YSHLVCFFKKRDSEPRGDTAARE 53 YSHLV +F + D D ARE Sbjct: 92 YSHLVDYFPEYDGPKHDDVKARE 114 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 24.6 bits (51), Expect = 4.1 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -1 Query: 340 DLTESIWEHMTGLLVGTVTDVGHQVLTLESPADSVVNTSR 221 D+ + H L + D+G + TLE+ D V +T+R Sbjct: 833 DMLRQAYGHFFDLTIVN-NDIGETIATLENAIDKVHSTAR 871 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 24.2 bits (50), Expect = 5.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 273 CPTSVTVPTRRPVICSQMDSV 335 CP + +P+RR C Q D + Sbjct: 420 CPVRINIPSRRCYRCWQTDHI 440 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 7.2 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +2 Query: 77 WFTVAFLKETYKMAIRPVYRPTIVKKRTKRFIRHQSDRYDKLKRN 211 W + AFL + A V + ++R +FI R+D++ N Sbjct: 104 WCSKAFLWAYFIYACETVIVLVVARERINKFISTSDKRFDEVIYN 148 >DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide F prepropeptide protein. Length = 234 Score = 23.8 bits (49), Expect = 7.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 235 QQSPQAIQGSILDAQHRLRFQQEDPSYA 318 QQ Q +I Q RLRF + DPS+A Sbjct: 146 QQDDVMQQKTIRAPQLRLRFGRTDPSWA 173 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 7.2 Identities = 10/23 (43%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 332 GIHLGAYDGSSCWNRNRC-WASS 267 G +LGA ++CWN + W SS Sbjct: 2749 GAYLGAASANNCWNPLKWDWRSS 2771 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 7.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 710 SNSITNFTNKAFFSLHS 660 SN+I NFT KAF L S Sbjct: 520 SNNIENFTRKAFKDLPS 536 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 23.8 bits (49), Expect = 7.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 97 KKRDSEPRGDTAAREGPKS*G 35 +KRD+ R +A RE PKS G Sbjct: 132 RKRDNNARQRSAQRETPKSSG 152 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 794,438 Number of Sequences: 2352 Number of extensions: 15650 Number of successful extensions: 32 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97160985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -