BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D15 (1003 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 25 0.92 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 3.7 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 6.5 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 6.5 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 22 8.6 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 22 8.6 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 22 8.6 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 25.0 bits (52), Expect = 0.92 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 765 GGXPXGGXPPGGKP 724 GG P GG PP G P Sbjct: 66 GGPPSGGQPPQGMP 79 Score = 24.2 bits (50), Expect = 1.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 725 GFPPGGXPPXGXPPGPXPP 781 G P GG PP G P PP Sbjct: 67 GPPSGGQPPQGMPYPRFPP 85 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.0 bits (47), Expect = 3.7 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -1 Query: 655 KXGPGGXGPXGXTPPXGP 602 K G GG G PP GP Sbjct: 523 KGGGGGSGSGNNQPPGGP 540 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 6.5 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -1 Query: 550 PPGKXPPXXGXPPXPP 503 P G PP G P PP Sbjct: 226 PTGLIPPHPGLSPHPP 241 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.2 bits (45), Expect = 6.5 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -1 Query: 550 PPGKXPPXXGXPPXPP 503 P G PP G P PP Sbjct: 118 PTGLIPPHPGLSPHPP 133 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 21.8 bits (44), Expect = 8.6 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = -1 Query: 778 GXGTRXGAXXGXAPRGETPGXPXXARXGXXPTPGXGGXXXXK 653 G TR G + ETPG P PT G K Sbjct: 306 GYTTREGMIVEMMRKNETPGMPNDFEEFVHPTVAKRGSITSK 347 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 8.6 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = -1 Query: 778 GXGTRXGAXXGXAPRGETPGXPXXARXGXXPTPGXGGXXXXK 653 G TR G + ETPG P PT G K Sbjct: 304 GYTTREGMIVEMMRKNETPGMPNDFEGFVHPTVAKRGSITSK 345 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.8 bits (44), Expect = 8.6 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = -1 Query: 778 GXGTRXGAXXGXAPRGETPGXPXXARXGXXPTPGXGGXXXXK 653 G TR G + ETPG P PT G K Sbjct: 306 GYTTREGMIVEMMRKNETPGMPNDFEEFVHPTVAKRGSITSK 347 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.316 0.152 0.544 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,122 Number of Sequences: 336 Number of extensions: 3061 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 28547508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -