BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D13 (902 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 24 1.4 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 24 1.4 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 23 3.3 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 23 3.3 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 22 5.7 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 24.2 bits (50), Expect = 1.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 591 VPLLPKKPLAMDLK*KLMIFLQ 656 +PLLPK PL + L KL+ +Q Sbjct: 45 MPLLPKTPLPLTLLYKLLGIIQ 66 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 24.2 bits (50), Expect = 1.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 591 VPLLPKKPLAMDLK*KLMIFLQ 656 +PLLPK PL + L KL+ +Q Sbjct: 1 MPLLPKTPLPLTLLYKLLGIIQ 22 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 23.0 bits (47), Expect = 3.3 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 446 LILLFNLFYNFKSLE*QINNLPVLSSL 366 + LLF LFY +K+++ I +L LS L Sbjct: 13 VFLLFYLFYCYKTIKQHIYSLISLSYL 39 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 23.0 bits (47), Expect = 3.3 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 446 LILLFNLFYNFKSLE*QINNLPVLSSL 366 + LLF LFY +K+++ I +L LS L Sbjct: 13 VFLLFYLFYCYKTIKQHIYSLISLSYL 39 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 22.2 bits (45), Expect = 5.7 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 Query: 677 PRIVRLGLIQHSIAISTDNPITQQRLAIFEK 769 P IVR L +H P T Q+L EK Sbjct: 102 PPIVRCALRKHKPNRKPRTPFTTQQLLALEK 132 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,944 Number of Sequences: 336 Number of extensions: 3326 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25134219 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -