BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D12 (879 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0496 + 3939731-3939758,3940459-3942773 32 0.70 05_01_0490 + 4083768-4083775,4083845-4084336,4084441-4084522,408... 29 3.7 >12_01_0496 + 3939731-3939758,3940459-3942773 Length = 780 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -3 Query: 271 WQV*MRAPT-QAVLVRYGSSQVLTQGSSVQWAFSGHPYSVVLASRAITATIR 119 WQ+ A +A L+ G+ V QG S+ W HP + +L + +TAT + Sbjct: 101 WQISSSAEAVRAELMDSGNLVVKDQGGSILWQSFDHPTNTLLPMQPVTATAK 152 >05_01_0490 + 4083768-4083775,4083845-4084336,4084441-4084522, 4086671-4087357,4087555-4087813,4088435-4088558, 4089474-4089564 Length = 580 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 227 VRVVAGPHAGVISPMGIFRASIFGSAGLESH 135 +R + GP+ G+ +FR SIFG AG ES+ Sbjct: 247 MRRMFGPNGGIGIAEMLFRTSIFGLAGAESN 277 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,339,612 Number of Sequences: 37544 Number of extensions: 253770 Number of successful extensions: 616 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2479731924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -