BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D06 (885 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0407 - 24983491-24983575,24983655-24984015,24984367-249844... 35 0.075 01_03_0217 + 13879259-13879270,13880322-13880683,13880771-13880855 33 0.30 >04_04_0407 - 24983491-24983575,24983655-24984015,24984367-24984406, 24984466-24984468 Length = 162 Score = 35.1 bits (77), Expect = 0.075 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = +3 Query: 708 KALKAQRKVVKGEHGKRVRKIRNSVHFRRPKXFEPPXHP*IPK 836 +ALKA + V G K +KIR SV F RPK + P P+ Sbjct: 26 QALKAAKAVKSGTAKKTTKKIRTSVTFHRPKTLKKSRDPKYPR 68 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 796 PRXLNLLXTXKYPXKSLPXRNRMDAYNII 882 P+ L KYP S P RN++D Y I+ Sbjct: 55 PKTLKKSRDPKYPRVSTPGRNKLDQYQIL 83 >01_03_0217 + 13879259-13879270,13880322-13880683,13880771-13880855 Length = 152 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = +3 Query: 708 KALKAQRKVVKGEHGKRVRKIRNSVHFRRPKXFEPPXHP*IPKXVSA 848 +ALK + V G ++ +KIR SV F RPK + P P+ VSA Sbjct: 16 QALKVAKAVKSGSIKRKSKKIRTSVTFHRPKTLKKARDPKYPR-VSA 61 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +1 Query: 754 REYGKFATLCISADPRXLNLLXTXKYPXKSLPXRNRMDAYNII 882 R+ K T P+ L KYP S P RN++D Y I+ Sbjct: 31 RKSKKIRTSVTFHRPKTLKKARDPKYPRVSAPGRNKLDQYQIL 73 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,092,403 Number of Sequences: 37544 Number of extensions: 161637 Number of successful extensions: 365 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 365 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2503236492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -