BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D06 (885 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57676| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_20380| Best HMM Match : Lipase_GDSL (HMM E-Value=0.24) 29 3.8 >SB_57676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = +3 Query: 708 KALKAQRKVVKGEHGKRVRKIRNSVHFRRPKXFEPPXHP*IPK 836 KA KA++ V KG + +K+R SV F RPK +P P+ Sbjct: 138 KAQKAKKAVQKGVRAAKTKKVRTSVKFHRPKTLSLRRNPKYPR 180 >SB_20380| Best HMM Match : Lipase_GDSL (HMM E-Value=0.24) Length = 416 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +2 Query: 590 CGNSSQNCQTQASSFQIEDCTEAQKDWD*GTKKSSETCY*ST*GSEEGCK 739 CGN + NC +A + E + DW +ETC SEE C+ Sbjct: 129 CGNGTSNCNCEACTDFSEVISAELYDW----VPQNETCVVKNYSSEEACR 174 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,641,833 Number of Sequences: 59808 Number of extensions: 177337 Number of successful extensions: 410 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2526446612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -