BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D06 (885 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55280.1 68416.m06139 60S ribosomal protein L23A (RPL23aB) va... 38 0.012 At2g39460.1 68415.m04843 60S ribosomal protein L23A (RPL23aA) id... 34 0.14 >At3g55280.1 68416.m06139 60S ribosomal protein L23A (RPL23aB) various ribosomal L23a proteins Length = 154 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/47 (44%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 699 PVTKALKAQRKVVKGEHGKR-VRKIRNSVHFRRPKXFEPPXHP*IPK 836 P KALKA + V G+ K+ +KIR V F RPK P P PK Sbjct: 14 PKAKALKAAKAVKSGQIVKKPAKKIRTKVTFHRPKTLTVPRKPKYPK 60 >At2g39460.1 68415.m04843 60S ribosomal protein L23A (RPL23aA) identical to GB:AF034694 Length = 154 Score = 33.9 bits (74), Expect = 0.14 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +3 Query: 699 PVTKALKAQRKVVKGE-HGKRVRKIRNSVHFRRPKXFEPPXHP*IPK 836 P KALKA + V G+ K+ +KIR V F RPK P PK Sbjct: 14 PKAKALKAAKAVKSGQAFKKKDKKIRTKVTFHRPKTLTKPRTGKYPK 60 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,725,493 Number of Sequences: 28952 Number of extensions: 135362 Number of successful extensions: 366 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 366 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2071520424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -