BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D05 (879 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 6.5 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 6.5 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 6.5 Identities = 20/89 (22%), Positives = 33/89 (37%) Frame = -2 Query: 527 NWQYVDSFSIFH*RTRSDGYHIRKTHTKVVSHNTVHPNFLIRAIIV*EHDANGFLAAFAL 348 +WQ D S+ G + + ++++ H + A IV ++ L Sbjct: 240 HWQ--DQMSLPQMLADKIGKMVNQKFSELIQSKPQHARRKVLAGIVQTKGSDAELICVTT 297 Query: 347 EQDCVTTEELKLLHFGL*KCHD*VVIADC 261 CV+ E L + L CH VV C Sbjct: 298 GTKCVSGEHLSVSGGALNDCHAEVVARRC 326 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 22.2 bits (45), Expect = 6.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 191 LLLSAILFKIYC*NLRTIIIFIT 123 +LLS+ F++ L TI+IF+T Sbjct: 1 MLLSSAWFEVIAAVLLTILIFVT 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 233,800 Number of Sequences: 438 Number of extensions: 4957 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28523595 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -