BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D02 (916 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1175 - 24555965-24556117,24557809-24558264,24558270-245584... 29 6.8 08_01_1027 - 10373760-10373837,10373918-10374201,10374286-10374394 28 9.0 >07_03_1175 - 24555965-24556117,24557809-24558264,24558270-24558436, 24558468-24558756,24559620-24559726,24559841-24559909, 24560001-24560109 Length = 449 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +2 Query: 302 GLFGKGGYNREFFNDDRGKLTGQAYGTRVLGPGGDSTSYGG 424 G+ G GG+ + G +G YGT G GG GG Sbjct: 113 GIRGGGGFGAGGYGSGGGYSSGGGYGTGEYGRGGGYAGNGG 153 >08_01_1027 - 10373760-10373837,10373918-10374201,10374286-10374394 Length = 156 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +1 Query: 526 ILVRILTCQLAEWSLRSSVTEGLMSVYRPRLLTSGNCQ 639 I+ RIL + EW L S V +M P L SGN + Sbjct: 82 IMERILREEAEEWELESEVRREIMEHIFPLLRRSGNAR 119 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,133,413 Number of Sequences: 37544 Number of extensions: 352270 Number of successful extensions: 819 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 797 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 819 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2600672280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -