BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_D02 (916 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 29 5.7 At1g16260.1 68414.m01947 protein kinase family protein contains ... 29 5.7 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +2 Query: 341 NDDRGKLTG--QAYGTRVLGPGGDSTSYGGR 427 N+DRG G YG R G GG + YGGR Sbjct: 52 NNDRGGYGGANSGYGGRGQGYGGRGSGYGGR 82 >At1g16260.1 68414.m01947 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +2 Query: 305 LFGKGGYNREFFNDDRGKLTGQAYGTRVLGPGGDSTSYGGRLD 433 L G + F ++D T + +R+LG GG T Y G L+ Sbjct: 368 LHGSVNRTKVFSSNDLENATDRFNASRILGQGGQGTVYKGMLE 410 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,207,082 Number of Sequences: 28952 Number of extensions: 264983 Number of successful extensions: 563 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2168774904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -