BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C24 (885 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 27 0.23 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 26 0.40 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 27.1 bits (57), Expect = 0.23 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 125 WRQTAFCFYKVRRATTKNTEKEETGLWNQXLRI 27 W Q FC+++ AT KN + L +R+ Sbjct: 533 WFQNTFCYFRRNAATWKNAVRHNLSLHKCFMRV 565 Score = 23.0 bits (47), Expect = 3.7 Identities = 9/28 (32%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -2 Query: 524 FLKVNSLESEEQQERHHK-TEQTHSLRQ 444 F++ +SL ++QQ++HH+ + H+ Q Sbjct: 91 FMQQHSLYLQQQQQQHHQDSSSEHASNQ 118 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 26.2 bits (55), Expect = 0.40 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = -2 Query: 503 ESEEQQERHHKTEQTHSLRQGETQNGV*EQLLLEGGVPGIADDEGAEDXSNTSSGTS 333 + ++QQ+R + ++ LR E + V E GG G+ D S ++ T+ Sbjct: 165 QQQQQQQRQQQRQEERRLRPDEIKVEVGEDEFANGGAARDESKAGSTDASTPATVTT 221 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,347 Number of Sequences: 438 Number of extensions: 3426 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28766349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -