BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C19 (896 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_42961| Best HMM Match : DNA_mis_repair (HMM E-Value=1.8e-19) 29 5.1 >SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 31.5 bits (68), Expect = 0.96 Identities = 19/65 (29%), Positives = 26/65 (40%) Frame = -3 Query: 351 CRPTACSSTPWCSVSCQ*SGC*LHSG*WSPCLGXHIPSSDGQHCRSRR*GCCCTVXPRGL 172 C+ CS++ C SC GC L+ + + C+SR G CT G Sbjct: 224 CQQVVCSASGKCDQSCDGEGCNLYCSEGAKTCNQKCQGACVTDCKSRWCGVTCT--GSGC 281 Query: 171 G*KCP 157 KCP Sbjct: 282 DVKCP 286 >SB_42961| Best HMM Match : DNA_mis_repair (HMM E-Value=1.8e-19) Length = 727 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -3 Query: 885 GRLERXNEPXSRCQEDRXXHHXVQRPCGLPRRSRFVPSS 769 G + + + R DR +RPC LP+ SR VP + Sbjct: 142 GFISKADHGSGRSSSDRQFFFINKRPCDLPKVSRVVPDT 180 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,521,358 Number of Sequences: 59808 Number of extensions: 458747 Number of successful extensions: 1097 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1096 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2574115416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -