BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C18 (899 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M64590-1|AAA36463.1| 1020|Homo sapiens glycine decarboxylase pro... 31 5.7 M63635-1|AAA36478.1| 1020|Homo sapiens glycine decarboxylase pro... 31 5.7 D90239-1|BAA14286.1| 1020|Homo sapiens glycine decarboxylase pre... 31 5.7 BC111995-1|AAI11996.1| 1020|Homo sapiens glycine dehydrogenase (... 31 5.7 BC111993-1|AAI11994.1| 1020|Homo sapiens glycine dehydrogenase (... 31 5.7 AL353718-2|CAH74116.1| 1036|Homo sapiens glycine dehydrogenase (... 31 5.7 AL162411-3|CAH69992.1| 1036|Homo sapiens glycine dehydrogenase (... 31 5.7 >M64590-1|AAA36463.1| 1020|Homo sapiens glycine decarboxylase protein. Length = 1020 Score = 31.1 bits (67), Expect = 5.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 759 HLQLSKQFCLRCWGKSRGIGIVGVHYELFVFFDNSVIIT 643 HL L K FC+ G G+G +GV L F N +I+ Sbjct: 749 HLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVIS 787 >M63635-1|AAA36478.1| 1020|Homo sapiens glycine decarboxylase protein. Length = 1020 Score = 31.1 bits (67), Expect = 5.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 759 HLQLSKQFCLRCWGKSRGIGIVGVHYELFVFFDNSVIIT 643 HL L K FC+ G G+G +GV L F N +I+ Sbjct: 749 HLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVIS 787 >D90239-1|BAA14286.1| 1020|Homo sapiens glycine decarboxylase precursor protein. Length = 1020 Score = 31.1 bits (67), Expect = 5.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 759 HLQLSKQFCLRCWGKSRGIGIVGVHYELFVFFDNSVIIT 643 HL L K FC+ G G+G +GV L F N +I+ Sbjct: 749 HLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVIS 787 >BC111995-1|AAI11996.1| 1020|Homo sapiens glycine dehydrogenase (decarboxylating) protein. Length = 1020 Score = 31.1 bits (67), Expect = 5.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 759 HLQLSKQFCLRCWGKSRGIGIVGVHYELFVFFDNSVIIT 643 HL L K FC+ G G+G +GV L F N +I+ Sbjct: 749 HLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVIS 787 >BC111993-1|AAI11994.1| 1020|Homo sapiens glycine dehydrogenase (decarboxylating) protein. Length = 1020 Score = 31.1 bits (67), Expect = 5.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 759 HLQLSKQFCLRCWGKSRGIGIVGVHYELFVFFDNSVIIT 643 HL L K FC+ G G+G +GV L F N +I+ Sbjct: 749 HLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVIS 787 >AL353718-2|CAH74116.1| 1036|Homo sapiens glycine dehydrogenase (decarboxylating) protein. Length = 1036 Score = 31.1 bits (67), Expect = 5.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 759 HLQLSKQFCLRCWGKSRGIGIVGVHYELFVFFDNSVIIT 643 HL L K FC+ G G+G +GV L F N +I+ Sbjct: 768 HLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVIS 806 >AL162411-3|CAH69992.1| 1036|Homo sapiens glycine dehydrogenase (decarboxylating) protein. Length = 1036 Score = 31.1 bits (67), Expect = 5.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 759 HLQLSKQFCLRCWGKSRGIGIVGVHYELFVFFDNSVIIT 643 HL L K FC+ G G+G +GV L F N +I+ Sbjct: 768 HLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVIS 806 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,132,173 Number of Sequences: 237096 Number of extensions: 2346962 Number of successful extensions: 5473 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 5169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5473 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11603768198 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -