BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C17 (893 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26460.1 68415.m03175 RED family protein similar to Red prote... 32 0.59 At1g11790.1 68414.m01353 prephenate dehydratase family protein s... 31 1.0 At1g76160.1 68414.m08844 multi-copper oxidase type I family prot... 29 3.1 At1g11000.1 68414.m01263 seven transmembrane MLO family protein ... 29 3.1 At1g01320.1 68414.m00048 tetratricopeptide repeat (TPR)-containi... 29 3.1 At1g67140.1 68414.m07638 expressed protein 29 5.5 At1g28380.1 68414.m03487 expressed protein 29 5.5 At1g23300.1 68414.m02914 MATE efflux family protein similar to r... 29 5.5 At3g45830.1 68416.m04960 expressed protein 28 7.3 At3g03773.1 68416.m00384 expressed protein 28 7.3 >At2g26460.1 68415.m03175 RED family protein similar to Red protein (RER protein) (Swiss-Prot:Q9Z1M8) [Mus musculus] Length = 585 Score = 31.9 bits (69), Expect = 0.59 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +3 Query: 81 PLPATEKEMDITAKQIEQPTSGSPPDKPKLMEGGNYIREGRDSTKS 218 PLP +D++ KQ E P + + D + EG +Y G+D T+S Sbjct: 266 PLPPGINHLDLSTKQEEPPVARTDDDDIFVGEGVDYTVPGKDVTQS 311 >At1g11790.1 68414.m01353 prephenate dehydratase family protein similar to gi|2392772 and is a member of the PF|00800 Prephenate dehydratase family. ESTs gb|T21562 and gb|T21062 come from this gene Length = 392 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +3 Query: 258 GSLARYLGIFSSHGVNLSHIESRSSTRRP 344 G L + L +F+ +NLS IESR RRP Sbjct: 306 GVLFKALAVFALRSINLSKIESRPQRRRP 334 >At1g76160.1 68414.m08844 multi-copper oxidase type I family protein similar to pollen-specific BP10 protein [SP|Q00624][Brassica napus]; contains Pfam profile: PF00394 Multicopper oxidase Length = 541 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Frame = +2 Query: 41 DFGLHKSLTLRTHASSSNRKRNG----HHGEAN*TTHVWLASRQAKIDGR 178 D+ L+++ +RT+ S+S + N H+G N T + LAS ++DG+ Sbjct: 313 DWSLNQARAIRTNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGK 362 >At1g11000.1 68414.m01263 seven transmembrane MLO family protein / MLO-like protein 4 (MLO4) identical to membrane protein Mlo4 [Arabidopsis thaliana] gi|14091578|gb|AAK53797; similar to MLO protein SWISS-PROT:P93766, NCBI_gi:1877221 [Hordeum vulgare][Barley] Length = 573 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 41 DFGLHKSLTLRTHASSSNRKRNGHHG 118 D+G+HK + L H SS+N+ HHG Sbjct: 101 DYGIHKKVLLE-HTSSTNQSSLPHHG 125 >At1g01320.1 68414.m00048 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|P46825 Kinesin light chain (KLC) {Loligo pealeii}; contains Pfam profile PF00515: TPR Domain Length = 1797 Score = 29.5 bits (63), Expect = 3.1 Identities = 19/96 (19%), Positives = 39/96 (40%), Gaps = 3/96 (3%) Frame = +3 Query: 360 VECEHGSGDFGAALEELKKNVGYLNIISRNYKDNRSAVPWFPRRIRDLDRF---ANQILS 530 V+ +G +G +++ + ++G + + + P F + D++ + S Sbjct: 1252 VQRPRSAGSYGRRMKQRRASIGKVYTYQKKNVEADIDNPLFQNATQQNDKYYILKKRTAS 1311 Query: 531 YGAELDSDHPGFTDPVYRDRRKYFADIAYNYKHGEP 638 Y + D PG T + RK +AY K +P Sbjct: 1312 YSSYADHHSPGLTTQGTKFGRKIVKTLAYRVKSTQP 1347 >At1g67140.1 68414.m07638 expressed protein Length = 2158 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 683 CSFPEVDRALPHSCLQRAQPCLPAA 757 CSF +D LPH+ +R QPCL A Sbjct: 1282 CSF--LDEILPHTVSRRLQPCLEEA 1304 >At1g28380.1 68414.m03487 expressed protein Length = 612 Score = 28.7 bits (61), Expect = 5.5 Identities = 19/67 (28%), Positives = 28/67 (41%), Gaps = 3/67 (4%) Frame = +3 Query: 78 TPLPATEK-EMDITAKQIEQPTSGSPPDKPKLME--GGNYIREGRDSTKSTWLLISPAAP 248 +P PAT K + I P SPP KPKL+ + G + W++ Sbjct: 529 SPNPATTKPQSKIDINSAVYPRGPSPPVKPKLLSLVDTKEVMRGPEEQPGYWVVTGAKLC 588 Query: 249 DEAGSLA 269 EAG ++ Sbjct: 589 VEAGKIS 595 >At1g23300.1 68414.m02914 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 515 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 96 EKEMDITAKQIEQPTSGSPPDKPKLMEGGNYIREGRDSTKSTWLLISPA 242 + E I+++Q + + S D P + G ++IR+ +K W L PA Sbjct: 7 DHEDTISSEQEHRAHTKSDTDMPPISGGRDFIRQFAAESKKLWWLAGPA 55 >At3g45830.1 68416.m04960 expressed protein Length = 1298 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 354 FMVECEHGSGDFGAALEELKKNVGYLNIISRNYKDN 461 F +E HGSGD ++ EE +KN N+ S + D+ Sbjct: 13 FDLEYSHGSGDSMSSYEERRKNSVVNNVDSEDEDDD 48 >At3g03773.1 68416.m00384 expressed protein Length = 150 Score = 28.3 bits (60), Expect = 7.3 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +3 Query: 387 FGAALEELKKNVGYLNIISRNYKDNRSAVPWFPRRIRDLDRFANQI 524 +G + E +KNVG NII K+ RS W+ R ++ ++ A I Sbjct: 57 YGKIMTEYRKNVGLRNIIFSIQKEERS---WWTRLLKSEEKPAPYI 99 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,585,631 Number of Sequences: 28952 Number of extensions: 513731 Number of successful extensions: 1609 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1609 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2100696768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -