BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C16 (912 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 27 1.0 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 3.2 DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 23 9.7 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 26.6 bits (56), Expect = 1.0 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +2 Query: 170 VCSSPLLTQTPFSEEDCIRQGGICVRTEECDPDNISTIS 286 + + LLT +E+DC+R GG + +P NI+ +S Sbjct: 854 IMAKALLTNRYVTEQDCLRVGGQHISCAG-NPPNIAAVS 891 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.0 bits (52), Expect = 3.2 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = -1 Query: 912 GGG--GGGXXXXXXXXPGGGGG 853 GGG GGG PGGGGG Sbjct: 208 GGGAPGGGGGSSGGPGPGGGGG 229 Score = 24.2 bits (50), Expect = 5.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 912 GGGGGGXXXXXXXXPGGGGG 853 GGGGG GGGGG Sbjct: 213 GGGGGSSGGPGPGGGGGGGG 232 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 23.4 bits (48), Expect = 9.7 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 6/60 (10%) Frame = +2 Query: 113 LKMKLIQCV-FVIVLLMAVTVC--SSPLLTQT-PFSEEDCIRQGGI--CVRTEECDPDNI 274 +K+ L+ CV + LL++ T + L Q+ +E +R+ CV T+EC PD + Sbjct: 1 MKLPLLCCVPLLAALLVSSTTAQHAEDALKQSYDGTESSAVREQPEQRCVPTKECPPDEV 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 685,999 Number of Sequences: 2352 Number of extensions: 14379 Number of successful extensions: 52 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 98814789 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -