BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C16 (912 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY094699-1|AAM11052.1| 98|Drosophila melanogaster GH10517p pro... 38 0.014 AE013599-3232|AAM70922.1| 98|Drosophila melanogaster CG10433-P... 38 0.014 AE013599-3231|AAF46736.1| 127|Drosophila melanogaster CG10433-P... 38 0.019 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 31 2.2 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 31 2.2 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 31 2.2 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 31 2.2 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 31 2.2 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 31 2.2 Y11128-1|CAA72010.1| 403|Drosophila melanogaster C901 protein p... 31 2.9 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 31 2.9 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 31 2.9 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 31 2.9 AE014298-1533|AAF47984.1| 559|Drosophila melanogaster CG1567-PA... 31 2.9 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 30 5.1 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 30 5.1 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 30 5.1 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 30 5.1 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 30 5.1 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 29 8.8 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 29 8.8 >AY094699-1|AAM11052.1| 98|Drosophila melanogaster GH10517p protein. Length = 98 Score = 38.3 bits (85), Expect = 0.014 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 206 SEEDCIRQGGICVRTEEC-DPDNISTISQFLCPNQAHLGVACCYV*RNS 349 ++ C+ GG+CV +C +P T ++ LCP A GV CCY R++ Sbjct: 47 NDRQCVMVGGLCVAESDCIEP----TSNKGLCPTSAGEGVECCYELRSN 91 >AE013599-3232|AAM70922.1| 98|Drosophila melanogaster CG10433-PB, isoform B protein. Length = 98 Score = 38.3 bits (85), Expect = 0.014 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 206 SEEDCIRQGGICVRTEEC-DPDNISTISQFLCPNQAHLGVACCYV*RNS 349 ++ C+ GG+CV +C +P T ++ LCP A GV CCY R++ Sbjct: 47 NDRQCVMVGGLCVAESDCIEP----TSNKGLCPTSAGEGVECCYELRSN 91 >AE013599-3231|AAF46736.1| 127|Drosophila melanogaster CG10433-PA, isoform A protein. Length = 127 Score = 37.9 bits (84), Expect = 0.019 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +2 Query: 206 SEEDCIRQGGICVRTEEC-DPDNISTISQFLCPNQAHLGVACCY 334 ++ C+ GG+CV +C +P T ++ LCP A GV CCY Sbjct: 47 NDRQCVMVGGLCVAESDCIEP----TSNKGLCPTSAGEGVECCY 86 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 31.1 bits (67), Expect = 2.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 476 PPPPPPPPLHAFVAPPPPP 494 Score = 30.7 bits (66), Expect = 2.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 478 PPPPPPLHAFVAPPPPPPP 496 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 496 PPPPPPPPLANYGAPPPPP 514 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 498 PPPPPPLANYGAPPPPPPP 516 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 31.1 bits (67), Expect = 2.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 486 PPPPPPPPLHAFVAPPPPP 504 Score = 30.7 bits (66), Expect = 2.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 488 PPPPPPLHAFVAPPPPPPP 506 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 506 PPPPPPPPLANYGAPPPPP 524 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 508 PPPPPPLANYGAPPPPPPP 526 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 31.1 bits (67), Expect = 2.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 476 PPPPPPPPLHAFVAPPPPP 494 Score = 30.7 bits (66), Expect = 2.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 478 PPPPPPLHAFVAPPPPPPP 496 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 496 PPPPPPPPLANYGAPPPPP 514 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 498 PPPPPPLANYGAPPPPPPP 516 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 31.1 bits (67), Expect = 2.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 634 PPPPPPPPLHAFVAPPPPP 652 Score = 30.7 bits (66), Expect = 2.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 636 PPPPPPLHAFVAPPPPPPP 654 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 654 PPPPPPPPLANYGAPPPPP 672 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 656 PPPPPPLANYGAPPPPPPP 674 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 31.1 bits (67), Expect = 2.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 581 PPPPPPPPLHAFVAPPPPP 599 Score = 30.7 bits (66), Expect = 2.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 583 PPPPPPLHAFVAPPPPPPP 601 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 601 PPPPPPPPLANYGAPPPPP 619 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 603 PPPPPPLANYGAPPPPPPP 621 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 31.1 bits (67), Expect = 2.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + + PPPPP Sbjct: 189 PPPPPYYPPYPYYPPPPPP 207 >Y11128-1|CAA72010.1| 403|Drosophila melanogaster C901 protein protein. Length = 403 Score = 30.7 bits (66), Expect = 2.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 185 LLTQTPFSEEDCIRQGGICVRTEEC 259 LL QTP + DC +Q G C + EC Sbjct: 207 LLCQTPICDPDCSKQHGYCRKPGEC 231 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 30.7 bits (66), Expect = 2.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 488 PPPPPPLPAFVAPPPPPPP 506 Score = 29.9 bits (64), Expect = 5.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 486 PPPPPPPPLPAFVAPPPPP 504 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 505 PPPPPPPPLANYGAPPPPP 523 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 507 PPPPPPLANYGAPPPPPPP 525 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 30.7 bits (66), Expect = 2.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 583 PPPPPPLPAFVAPPPPPPP 601 Score = 29.9 bits (64), Expect = 5.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 581 PPPPPPPPLPAFVAPPPPP 599 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 600 PPPPPPPPMANYGAPPPPP 618 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 602 PPPPPPMANYGAPPPPPPP 620 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 30.7 bits (66), Expect = 2.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 716 PPPPPPLPAFVAPPPPPPP 734 Score = 29.9 bits (64), Expect = 5.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP F PPPPP Sbjct: 714 PPPPPPPPLPAFVAPPPPP 732 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 733 PPPPPPPPMANYGAPPPPP 751 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 735 PPPPPPMANYGAPPPPPPP 753 >AE014298-1533|AAF47984.1| 559|Drosophila melanogaster CG1567-PA protein. Length = 559 Score = 30.7 bits (66), Expect = 2.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 185 LLTQTPFSEEDCIRQGGICVRTEEC 259 LL QTP + DC +Q G C + EC Sbjct: 205 LLCQTPICDPDCSKQHGYCRKPGEC 229 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 29.9 bits (64), Expect = 5.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 805 PXPGGGXXXXXXXXXXPPPXPXXXXXXXXGPPXPPP 912 P PGGG PPP P GPP PPP Sbjct: 516 PPPGGGGAP-------PPPPPPMPGRAGGGPPPPPP 544 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 29.9 bits (64), Expect = 5.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 805 PXPGGGXXXXXXXXXXPPPXPXXXXXXXXGPPXPPP 912 P PGGG PPP P GPP PPP Sbjct: 516 PPPGGGGAP-------PPPPPPMPGRAGGGPPPPPP 544 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 29.9 bits (64), Expect = 5.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 167 PPPPPPTKKVVYTPPPPPP 185 Score = 29.9 bits (64), Expect = 5.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 180 PPPPPPTKKVVYTPPPPPP 198 Score = 29.9 bits (64), Expect = 5.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 193 PPPPPPTKKVVYTPPPPPP 211 Score = 29.9 bits (64), Expect = 5.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 280 PPPPPPTKKVVYTPPPPPP 298 Score = 29.9 bits (64), Expect = 5.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PPPPP + PPPPP Sbjct: 293 PPPPPPTKKVVYTPPPPPP 311 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 29.9 bits (64), Expect = 5.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 805 PXPGGGXXXXXXXXXXPPPXPXXXXXXXXGPPXPPP 912 P PGGG PPP P GPP PPP Sbjct: 516 PPPGGGGAP-------PPPPPPMPGRAGGGPPPPPP 544 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 29.9 bits (64), Expect = 5.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 805 PXPGGGXXXXXXXXXXPPPXPXXXXXXXXGPPXPPP 912 P PGGG PPP P GPP PPP Sbjct: 516 PPPGGGGAP-------PPPPPPMPGRAGGGPPPPPP 544 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 29.1 bits (62), Expect = 8.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PP PPG + PPPPP Sbjct: 223 PPGPPGPPGTTYPQPPPPP 241 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 29.1 bits (62), Expect = 8.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 854 PPPPPGXXXFXFXXPPPPP 910 PP PPG + PPPPP Sbjct: 225 PPGPPGPPGTTYPQPPPPP 243 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,109,913 Number of Sequences: 53049 Number of extensions: 708957 Number of successful extensions: 5584 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4432 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4464466254 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -