BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C15 (913 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1201 - 11419851-11419913,11420090-11420311 32 0.73 04_03_0380 - 15150814-15152304 29 5.1 04_03_0348 + 14735581-14737071 29 5.1 03_02_0916 + 12364557-12364906,12365485-12365592,12365731-12366343 29 6.8 10_08_0940 - 21708557-21708733,21709058-21709142,21709330-217095... 28 9.0 >07_01_1201 - 11419851-11419913,11420090-11420311 Length = 94 Score = 31.9 bits (69), Expect = 0.73 Identities = 25/83 (30%), Positives = 34/83 (40%), Gaps = 5/83 (6%) Frame = +2 Query: 545 LRPPDEHHKNRRSSQRWRN--PTGL*RYQAFPPGKLPRALSCSDPAAYPD---TCPPFSL 709 L PP Q+WR+ PTG + +FP G LP A PA PD P F Sbjct: 13 LLPPPPPLPALPQGQQWRSTGPTGKLCFCSFPAGALPPAAGAGQPA--PDRQPATPLFPS 70 Query: 710 REAWRFLIXHAVXISVRCXSFAP 778 R A + + + + +F P Sbjct: 71 RVAEGLFGLNGIEVGIEGDNFTP 93 >04_03_0380 - 15150814-15152304 Length = 496 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -2 Query: 723 RHASRREKGGQVSG*AAGSEQESARGSXPGGNA 625 R A EKG ++ AAG ++ +AR + PGG A Sbjct: 440 REAMEGEKGAEMRRRAAGWKEAAARAARPGGPA 472 >04_03_0348 + 14735581-14737071 Length = 496 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -2 Query: 723 RHASRREKGGQVSG*AAGSEQESARGSXPGGNA 625 R A EKG ++ AAG ++ +AR + PGG A Sbjct: 440 REAMEGEKGAEMRRRAAGWKEAAARAARPGGPA 472 >03_02_0916 + 12364557-12364906,12365485-12365592,12365731-12366343 Length = 356 Score = 28.7 bits (61), Expect = 6.8 Identities = 22/56 (39%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +3 Query: 357 PLPRSLTRCARSF--GCGERYQLTQRR*YGYPQNQGITQ--ERTCEQKASKRPGTV 512 P PRS RC GCG R Q TQR P N IT E TC ++ P + Sbjct: 150 PYPRSYYRCTHKLDQGCGARRQ-TQRC-EADPSNYDITYYGEHTCRDPSTIIPTAI 203 >10_08_0940 - 21708557-21708733,21709058-21709142,21709330-21709551, 21710640-21710815,21711883-21711946,21712433-21712507, 21715114-21715199,21715297-21716715 Length = 767 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +3 Query: 306 NESAN---ARGEAVCVLGALPLPRSLTRCAR 389 +ESAN AR EAV +G +P+ L RC+R Sbjct: 434 DESANVDAARSEAVMRVGGIPMLLDLARCSR 464 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,601,443 Number of Sequences: 37544 Number of extensions: 466101 Number of successful extensions: 1239 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1239 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2588957540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -