BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C13 (907 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC613.05c |rpl35||60S ribosomal protein L35|Schizosaccharomyce... 46 1e-05 SPAC3H8.06 |aur1||inositol phosphorylceramide synthase |Schizosa... 27 4.8 >SPCC613.05c |rpl35||60S ribosomal protein L35|Schizosaccharomyces pombe|chr 3|||Manual Length = 122 Score = 45.6 bits (103), Expect = 1e-05 Identities = 22/54 (40%), Positives = 31/54 (57%) Frame = +2 Query: 176 LRVAKVXGGVASKLSKLRVVSKAXARVYIVYHQXXXVNLRNHXKNKXYKPLEFK 337 LRV K+ GG SKLSK++ K AR+ V ++ + R KNK Y PL+ + Sbjct: 30 LRVQKIAGGSGSKLSKIKTTRKDIARILTVINESNRLAAREAYKNKKYIPLDLR 83 >SPAC3H8.06 |aur1||inositol phosphorylceramide synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 422 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = -2 Query: 468 IIYSSFNGIDSRW---EERFLSDLFPRLDLCF 382 +++ +F + + W E FLS +FPR CF Sbjct: 246 VVFGAFPSLHAGWAMLEALFLSHVFPRYRFCF 277 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,659,236 Number of Sequences: 5004 Number of extensions: 17099 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 458501510 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -