SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP02_F_C13
         (907 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_03_0340 + 17946133-17946136,17946207-17946342,17946428-179465...    48   1e-05

>02_03_0340 +
           17946133-17946136,17946207-17946342,17946428-17946584,
           17947330-17947458
          Length = 141

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 27/65 (41%), Positives = 35/65 (53%)
 Frame = +2

Query: 176 LRVAKVXGGVASKLSKLRVVSKAXARVYIVYHQXXXVNLRNHXKNKXYKPLEFKXPRXPV 355
           LRVAKV GG  +KLSK++VV  + ARV  V  Q     LR   K K   PL+ +  +   
Sbjct: 31  LRVAKVTGGAPNKLSKIKVVRTSIARVLTVISQKQRAALREAYKKKSLLPLDLRPKKTRA 90

Query: 356 LCARL 370
           +  RL
Sbjct: 91  IRRRL 95


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,420,937
Number of Sequences: 37544
Number of extensions: 110849
Number of successful extensions: 165
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 165
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 165
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2565528060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -