BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C13 (907 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38468| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.5e-23) 58 7e-09 >SB_38468| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.5e-23) Length = 131 Score = 58.4 bits (135), Expect = 7e-09 Identities = 35/84 (41%), Positives = 48/84 (57%) Frame = +2 Query: 176 LRVAKVXGGVASKLSKLRVVSKAXARVYIVYHQXXXVNLRNHXKNKXYKPLEFKXPRXPV 355 LRVAKV GG ASKLSK++VV K+ ARV V Q NLR + K Y PL+ + P+ Sbjct: 39 LRVAKVTGGAASKLSKIKVVRKSVARVLTVVSQTQRDNLRKFYRKKKYLPLDLR-PKL-T 96 Query: 356 LCARLLLNTKQRSXRGKRSERNLS 427 R L K+ S + + ++ L+ Sbjct: 97 RAMRRSLTKKEASSKTLKQQKKLA 120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,971,618 Number of Sequences: 59808 Number of extensions: 132123 Number of successful extensions: 137 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2609867019 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -