BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C12 (906 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 25 0.81 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 3.3 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 4.3 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 7.6 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 25.0 bits (52), Expect = 0.81 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +1 Query: 346 WTKDGKEIVKSYFPI-QFRVIFTEQTVKLINKRDHHALKLIDQ 471 +T KE++ F + +FR+ Q K+I + DH ALK + + Sbjct: 642 YTTTEKELLGVIFALHKFRIYI--QVTKIIIRTDHQALKFLSR 682 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 547 VLENNRVYFKIMSTEDKQYLKLDNTK 624 ++E VY+K +ST+DK +K + K Sbjct: 1230 IVEYYTVYYKPVSTDDKTEVKPTSQK 1255 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 4.3 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -3 Query: 520 CWFCLWSHRMQFCCGFV 470 C F +++ + FCC F+ Sbjct: 171 CAFIIFTMHLLFCCAFI 187 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.8 bits (44), Expect = 7.6 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -2 Query: 527 TFLLVLSLESPNAILLWFCWSINLRA*WSLLFMSLTV 417 T+L+ E + +LW C S N +L +S TV Sbjct: 242 TYLIWTIYEMYHLAILWSCTSTNCPRFLIMLALSYTV 278 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,507 Number of Sequences: 336 Number of extensions: 4673 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25237652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -