BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C12 (906 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 25 1.3 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 24 1.7 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 24 1.7 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 24 1.7 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 24 2.2 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 24.6 bits (51), Expect = 1.3 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +1 Query: 349 TKDGKEIVKSYFPIQFRVIFTEQTVKLINKRDHHALKLIDQQNHNKIA 492 T + K+I K P + ++I V ++ DH L+D + IA Sbjct: 124 TMENKDITKRPLPNESQLIKRHPIVTIMGHVDHGKTTLLDALRNTSIA 171 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 24.2 bits (50), Expect = 1.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 228 AIAKCSEYLKEKKGEVIKEAVKRLIEN 308 A+A + +K+ EVIK+ +K L+EN Sbjct: 71 ALATDCKKCTDKQREVIKKVIKFLVEN 97 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 24.2 bits (50), Expect = 1.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 228 AIAKCSEYLKEKKGEVIKEAVKRLIEN 308 A+A + +K+ EVIK+ +K L+EN Sbjct: 71 ALATDCKKCTDKQREVIKKVIKFLVEN 97 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 24.2 bits (50), Expect = 1.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 228 AIAKCSEYLKEKKGEVIKEAVKRLIEN 308 A+A + +K+ EVIK+ +K L+EN Sbjct: 71 ALATDCKKCTDKQREVIKKVIKFLVEN 97 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 23.8 bits (49), Expect = 2.2 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 828 NRXLLRCAPRLHVF 787 NR + CAP+LHVF Sbjct: 145 NRTVPVCAPKLHVF 158 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 241,568 Number of Sequences: 438 Number of extensions: 5232 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29388177 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -