BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C10 (914 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 56 4e-08 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 48 1e-05 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 47 2e-05 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 44 2e-04 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 44 2e-04 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 43 3e-04 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 43 4e-04 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 43 4e-04 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 42 7e-04 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 41 0.001 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 41 0.002 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 41 0.002 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 40 0.004 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 39 0.005 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 39 0.006 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 39 0.006 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 38 0.009 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 38 0.011 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 38 0.011 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 38 0.015 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 38 0.015 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 37 0.026 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 37 0.026 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 37 0.026 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 37 0.026 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 37 0.026 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 37 0.026 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 37 0.026 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 36 0.035 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) 36 0.046 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 36 0.060 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 36 0.060 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 36 0.060 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 36 0.060 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 36 0.060 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 36 0.060 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 35 0.080 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 35 0.080 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 35 0.11 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 35 0.11 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 35 0.11 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 35 0.11 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 35 0.11 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 34 0.14 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 34 0.14 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 34 0.14 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 34 0.18 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.18 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 34 0.18 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 34 0.18 SB_57323| Best HMM Match : ShTK (HMM E-Value=0) 34 0.18 SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) 34 0.18 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 33 0.24 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) 33 0.24 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 33 0.24 SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 33 0.24 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 33 0.32 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 33 0.32 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 33 0.32 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 33 0.32 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 33 0.32 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 33 0.32 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 33 0.43 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 33 0.43 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 32 0.56 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 32 0.56 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 32 0.56 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 32 0.56 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 32 0.56 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 32 0.74 SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) 32 0.74 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 32 0.74 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 32 0.74 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 32 0.74 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 32 0.74 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 32 0.74 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 32 0.74 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 32 0.74 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 32 0.74 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 31 0.98 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 31 0.98 SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 31 0.98 SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 31 0.98 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 31 0.98 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 31 0.98 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 31 1.3 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 31 1.3 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 31 1.3 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 31 1.3 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_17315| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 31 1.7 SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 31 1.7 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 31 1.7 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 31 1.7 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 31 1.7 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 31 1.7 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 30 2.3 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 30 2.3 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 30 2.3 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 30 2.3 SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) 30 2.3 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 30 2.3 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 30 2.3 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_58049| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 30 3.0 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) 30 3.0 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 29 4.0 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 29 4.0 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_9191| Best HMM Match : TolA (HMM E-Value=1) 29 4.0 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 29 4.0 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 29 4.0 SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 29 4.0 SB_36009| Best HMM Match : Collagen (HMM E-Value=0) 29 5.2 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 29 5.2 SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 29 5.2 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 29 5.2 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 29 5.2 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 29 6.9 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 29 6.9 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_36007| Best HMM Match : Collagen (HMM E-Value=9e-25) 29 6.9 SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 29 6.9 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 29 6.9 SB_45391| Best HMM Match : DUF1509 (HMM E-Value=1.9) 29 6.9 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_56738| Best HMM Match : Extensin_2 (HMM E-Value=0.076) 28 9.2 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 28 9.2 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 28 9.2 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 28 9.2 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 28 9.2 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 28 9.2 SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_36777| Best HMM Match : VWA (HMM E-Value=0) 28 9.2 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 28 9.2 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 28 9.2 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 56.0 bits (129), Expect = 4e-08 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PPP PPPP P PP PPP P PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 55.6 bits (128), Expect = 5e-08 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PPP PPPP P PP PPP AP PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 54.4 bits (125), Expect = 1e-07 Identities = 23/56 (41%), Positives = 24/56 (42%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P + P P P P P PPP PPPP P PP P P P PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P P P P P P PPP PPPP P PP PPP P P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 52.8 bits (121), Expect = 4e-07 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PPP PPPP P PP PPP P PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 52.8 bits (121), Expect = 4e-07 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PPP PPPP P PP PPP P PP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P Q P P P PPP PPPP P P PPP P PP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 51.6 bits (118), Expect = 9e-07 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P +P P P PPP PPPP P P PPP P PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PP PPPP P PP PPP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 PP P + P P P P P PPP PP P P PP PPP A Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 45.6 bits (103), Expect = 6e-05 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PPP PPPP P PP P PP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 736 GXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G PPP PPPP P PP PPP P PP Sbjct: 360 GINMSPPPPPPPPPP-PPSPPPPPPPPPPSPPP 391 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP APP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P PA PP PP Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP+ PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 404 PPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPP 393 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPP 397 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 50.0 bits (114), Expect = 3e-06 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P GG PP P P G P P G P PPP P P PP PPP Sbjct: 936 PPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/70 (34%), Positives = 25/70 (35%), Gaps = 6/70 (8%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXP------XGXXPGXPPPXXPPPPRXPXPPX 801 P GG PP P + P G P P PG P PPPP PP Sbjct: 925 PPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPP 984 Query: 802 XPPPXAPXXP 831 PPP P P Sbjct: 985 PPPPPPPPPP 994 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/72 (31%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP------PPPRXPXPP 798 +P GG PP P P G P G PP P PPP PP Sbjct: 913 SPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPP 972 Query: 799 XXPPPXAPXXPP 834 PPP PP Sbjct: 973 LPPPPGGSAPPP 984 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +1 Query: 676 PXATPGXXXGP---XXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P TPG P G P PG P PPPP P PPP PP Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPP 955 Score = 37.1 bits (82), Expect = 0.020 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPP----PXXPPPPRXPXPPXXPPPXAPXXPP 834 P A+P P P P PP P PPPP PP PPP PP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP--XXPPPPR 783 P GG PP P + G P P G P PPP PPP R Sbjct: 947 PPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMR 996 Score = 33.9 bits (74), Expect = 0.18 Identities = 25/72 (34%), Positives = 26/72 (36%), Gaps = 2/72 (2%) Frame = -2 Query: 535 PPXXGXAPXPXPPPXTXXGT*AGG*XGXGGRTGXXGXXFWGPXXPPPPXXPXXXPXG--P 362 PP G AP P PPP G+ GG P PPPP P G P Sbjct: 924 PPPGGNAPLPPPPP---GGSAPSQPPPPGGN---------APPPPPPPGGSAPPPGGGAP 971 Query: 361 AXXPPSXXGAPP 326 PP APP Sbjct: 972 PLPPPPGGSAPP 983 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -1 Query: 536 PPXPWPXPXPXPPPXXXXRDLSRGVXGXGGAXRXSGGXLLGXPXAPPPPXXPXXPXG 366 PP P P PPP G G GG P PPPP P G Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGG--GAPPLPPPPGGSAPPPPPPPPPPPPPMRKLG 999 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 50.0 bits (114), Expect = 3e-06 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PPP PP P P PP PPP AP PP Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 49.6 bits (113), Expect = 3e-06 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P P P P P P P PPPP P PP PPP AP P Sbjct: 178 PYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP--PPPRXPXPPXXPPPXAPXXPP 834 P P P P P P PPP P PPP P PP PPP AP PP Sbjct: 120 PNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPP 177 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P A P P P P PPP P P P PP PPP AP P Sbjct: 167 PPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PPP P P P P PPP P PP Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Score = 45.6 bits (103), Expect = 6e-05 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P P PPP PPPP P PP P P P PP Sbjct: 128 PNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPN-PPPPNAPYPPPPYPPP 182 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P P P PPPP P P PPP P PP Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNP---PPPNPPYPPP 214 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P PPP PPP P PP PPP AP PP Sbjct: 93 PYPPPPYPPYPPPPPYPPP--PNPPYPPPPNAPYPPP 127 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PPP PP P P P P P AP PP Sbjct: 97 PPYPPYPPPPPYPPPPNP-PYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPP 151 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P P P P P P P P P PPPP P PP PPP Sbjct: 191 PNPPYPPPPNAPNPPPPNPPYPP--PPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P PP P PP PPP P PP Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPP 119 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P P P P P PP P PP PPP P PP Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP-PPNPPYPPPPNPPYPPP 198 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPP---XXPPPPRXPXP-PXXPPPXAPXXPP 834 P P + P P P P PPP PPPP P P P PPP P PP Sbjct: 139 PYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPP 197 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP--XXPPPXAPXXPP 834 P P P P P P P PP PP P P PP PPP P PP Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P P P P P PPP P P P PP P P P P Sbjct: 183 PNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXP-GXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P A P P P PPP PPP PP PPP P PP Sbjct: 133 PPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPP 189 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 4/59 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP----PRXPXPPXXPPPXAPXXP 831 PP + P P P P PP PPP P P PP PPP AP P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPP 142 Score = 36.7 bits (81), Expect = 0.026 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +1 Query: 688 PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP--XXPPPXAPXXPP 834 P P P P P PP PP P P PP PPP P PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPP 134 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P P P P P P P PP P P PP P P +P P Sbjct: 95 PPPPY--PPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAP 147 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 114 PPYPPPPNAPYPPPPNPPYPPPPNAPYPP 142 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 177 PPYPPPPNPPYPPPPNPPYPPPPNAPNPP 205 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 193 PPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 48.4 bits (110), Expect = 8e-06 Identities = 25/63 (39%), Positives = 25/63 (39%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPX 825 GGGG PP P P P P P P PP PPP P PP PP P Sbjct: 340 GGGGVNPPPPPTNNPPSPPPPTNNTPPPPP---PTNKPPPPPPPTNGP-PPPPPPTNGPP 395 Query: 826 XPP 834 PP Sbjct: 396 PPP 398 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +1 Query: 691 GXXXGPXXGQRPXPXGXXPGXPPP----XXPPPPRXPXPPXXPPPXAPXXPP 834 G G P P P PPP PPPP PP PP P PP Sbjct: 337 GTSGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 702 RXRXXPTARXXGXXPRXPPPXXPPPPPXPXPP 797 R + R G P P P PPPPP PP Sbjct: 58 RLKGRTVRRITGGAPSTPAPPPPPPPPSSGPP 89 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 736 GXXPGXPPPXXPPPPRXPXPPXXP 807 G P P P PPPP PP P Sbjct: 69 GGAPSTPAPPPPPPPPSSGPPLPP 92 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +1 Query: 649 GGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 GGG PP P P P P P G P PPP PPP PP PPP Sbjct: 286 GGGAPVPPPP---PADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 GGG PP P G P P P G P PPP PPPP P PPP Sbjct: 286 GGGAPVPPPPP--ADGSAPAPPP---PPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P PP GAPP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPP 332 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP 777 P G PP P PG P P P G PPP PPP Sbjct: 295 PPADGSAPAPPPPPP-PGGAPPPPPPPPPPPPGDGGAPPPP--PPP 337 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 47.2 bits (107), Expect = 2e-05 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +1 Query: 736 GXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G P PPP PPPP P PP PPP P PP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 46.0 bits (104), Expect = 4e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP PPPP P PP PPP P PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 45.2 bits (102), Expect = 7e-05 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 736 GXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G PPP PPPP P PP PPP P PP Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 GQ P P P PPP PPPP P PP PPP P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPP--PPPPPFPPPPPP 494 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 691 GXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 G G P P P PPP PPPP P PP PPP P Sbjct: 455 GDTEGVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPP--PPPPTP 496 Score = 35.1 bits (77), Expect = 0.080 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 685 TPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP 807 T G P P P P PPP PPPP P PP P Sbjct: 457 TEGVGQAPPPPPPPPPPPPPPPPPPP-PPPPPFPPPPPPTP 496 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 415 GPXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 G PPPP P P P PP PP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPP 490 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/64 (40%), Positives = 26/64 (40%), Gaps = 3/64 (4%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXP-PPXXPPPPR--XPXPPXXPP 810 P G PP P A P G P P G P P PP PPPPR P PP P Sbjct: 1226 PMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPG 1285 Query: 811 PXAP 822 P P Sbjct: 1286 PPGP 1289 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 46.4 bits (105), Expect = 3e-05 Identities = 29/70 (41%), Positives = 29/70 (41%), Gaps = 6/70 (8%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXG---PXXGQRPXPXGXXPGXPPPXXPPPP--RXPXPPX- 801 P GGG PP PG G P G P P G P PP PPPP R P PP Sbjct: 446 PQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPP---PPFGPPPPFYRGPPPPRG 502 Query: 802 XPPPXAPXXP 831 PPP P Sbjct: 503 MPPPPRQRMP 512 Score = 39.5 bits (88), Expect = 0.004 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 7/63 (11%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPX----PXGXXPGXPPPXX---PPPPRXPXPPXXPPPXAPX 825 PP P G G Q P P G G PPP PPP P PP PPP Sbjct: 436 PPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYR 495 Query: 826 XPP 834 PP Sbjct: 496 GPP 498 Score = 33.1 bits (72), Expect = 0.32 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXG--QRPXPXGXXPGXPPP-----XXPPPPRXPXPPXXPPPXAPX 825 PP P T P G Q P P PPP PPPP PP P P Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPF 487 Query: 826 XPP 834 PP Sbjct: 488 GPP 490 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P A P P P P PP PP P P PP P P P PP Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP-XXPPPPRXPXPPXXPPPXAPXXPP 834 PP P + P P P PP PPPP P PP P AP PP Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P A P P P P PPP PPP P PPP P P Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQR-PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P A P P P P P PPP P P+ PP PP P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQ---PPPAPPHFLP 114 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPP----PRXPXPPXXPPPXAPXXPP 834 P P P P PPP P P PP PP P PP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPP 90 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP 774 P PP P A P P P P P PP PP Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPPXF 320 P PPPP P PA P APP F Sbjct: 82 PAAPPPPPPLPAPPPPPAQPAPQPPPAPPHF 112 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G GGG GGG G G G G G A G GG Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGG 848 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G G G GG G GGGG GGG G G G G G G GG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G GGGG GG G G G G G G GG Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG 834 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GGG GG G GGGG GG G G G G G G G Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG G G GGGG GGG G G G G G GG Sbjct: 797 GGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGG 852 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GG GG G GGGG GGG G G G G G G GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG G G GGGG GGG G G G G G G G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GGG GG G GGGG GGG G Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG GGG GG G GGGG GGG G G G Sbjct: 840 GGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXGXPK 421 A + GGG G GGG G GG G GGGG G K Sbjct: 843 ADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVIK 879 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G GGG G G G G G G G GG Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Score = 37.9 bits (84), Expect = 0.011 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G G G GG G GGGG GGG G G G G G G GG Sbjct: 801 GGDGGGYGDGDGGGGG--GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGG 854 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 37.1 bits (82), Expect = 0.020 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GGG G GG G GGGG G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGG 800 Score = 36.3 bits (80), Expect = 0.035 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G + GGG G GGG G GG G G GG G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYG 808 Score = 35.9 bits (79), Expect = 0.046 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG GG GG G GGGG GGG G G G Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 35.5 bits (78), Expect = 0.060 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG GG G GGG G G G G G G G G GG Sbjct: 805 GGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGG 860 Score = 35.1 bits (77), Expect = 0.080 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG GGGG G Sbjct: 786 GGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 35.1 bits (77), Expect = 0.080 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG GGG GGG G G G G G GG Sbjct: 815 GGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 35.1 bits (77), Expect = 0.080 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -1 Query: 833 GGXXGAXGG---GXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GG G GG G GGGG GGG G G G Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 35.1 bits (77), Expect = 0.080 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G G GGG G GG G GGGG G Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G G GGG G GG G GGGG G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGG 802 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGG G Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGG 817 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G G G GGGG G Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGG 821 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G G G GGGG G Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGG 819 Score = 33.9 bits (74), Expect = 0.18 Identities = 24/75 (32%), Positives = 25/75 (33%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRXXX 492 G G GGG GG D G G GGGG G + Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGG 851 Query: 493 XGGGXGXGXGXGXGG 537 GGG G G G G GG Sbjct: 852 GGGGGGGGGGGGGGG 866 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G G GG G GGGG G Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GG G G Sbjct: 808 GDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG G G GGG GG G G G G G GG Sbjct: 814 GGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGG 869 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 + GG G GGG G GG G GGGG G Sbjct: 838 DGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G + GGG G GGG G GG G G G G Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGG 814 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG G G GGG G G G G G G G GG Sbjct: 820 GGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 319 GXGGGPPXXRGGXGXDPXGXXGXXGGGGAXG 411 G GGG GG G D G G GGGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGG 799 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G GGG G GG G GGGG G Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GGG GG G GGGG G Sbjct: 828 GGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGG 860 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G + GG G GGG G GG G GGG G Sbjct: 801 GGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDG 833 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXG 411 G G GGG GG G G G GGGG G Sbjct: 835 GFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGG 867 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G G G G Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGG 813 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GGG G G G GGGG G Sbjct: 822 GGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGG 854 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG G GGG G G G GGG Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGG 841 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G G GGG G GG G G GG G Sbjct: 806 GYGDGDGGGGGGGGGGG-GGGDGGGYGDGGGFG 837 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GGG GG G GGGG GGG G G G G G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG G GGGG GGG G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 G G GGG GG G GGGG GGG G G G G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G + GGG G GGG G GG G GGGG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G GGG GG G GGGG GGG G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 692 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 35.1 bits (77), Expect = 0.080 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GG G G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 + G G G GGG G GG G GGGG G Sbjct: 655 DYGDGGDGGGGGGGGGGGGGGGGGGGGGGGG 685 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -1 Query: 809 GGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GG G GGGG GGG G G G G G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GG G Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G G G G Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 794 GXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGGG GGG G G G G G G GG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 29.5 bits (63), Expect = 4.0 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GG G GGGG GGG G G G G G G G Sbjct: 657 GDGGDGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP PPPP P PP PPP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 35.1 bits (77), Expect = 0.080 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P PPP P PP P PP PPP P Sbjct: 1158 PPPPPPPPPPPSSPSPP--PPPPPPPPPPTP 1186 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 Q P P P PP PPP P PP P P Sbjct: 1155 QIPPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 403 PPPPXXPXXXPXGPAXXPPSXXGAPP 326 PPPP P P P+ PP PP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPP 1183 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 Q P P P PPP PPPP P PP PPP P P Sbjct: 203 QPPPPPPRPPPSPPP--PPPPPSPSPPRPPPPPPPSPP 238 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP PP P P PP P P P PP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PPP P PPR PP P PP Sbjct: 206 PPPPRPPPSPPPPP-----PPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P RP P P PP PP P P PP P P A P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLP 246 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P PPP P PP PPP P P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSP 224 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 717 PTARXXGXXPRXPPPXXPPPPPXPXPP 797 PT+ P PPP PP PP P PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPP 221 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 5/60 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPP----PXXPPPPRXPX-PPXXPPPXAPXXP 831 PP P +P P P P P PP P PP P PP PPP P Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTLGYLP 267 Score = 32.7 bits (71), Expect = 0.43 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP--PRXPXPPXXP--PPXAPXXPP 834 PP P P P P P P PPP P P + P PP P PP P PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPP-PPPPSPPRPLAAKLPEPPPIPNMPPTLP--PP 261 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 PP P +P P P P PPP PP P P P A Sbjct: 219 PPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTLGYLPTA 269 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 42.7 bits (96), Expect = 4e-04 Identities = 41/173 (23%), Positives = 44/173 (25%), Gaps = 6/173 (3%) Frame = +1 Query: 331 GPPXXRGGXGXDPX--GXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRXXXXGGG 504 GPP +G G G G G G G P PP P P++ G Sbjct: 73 GPPGFQGPPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGP 132 Query: 505 XGXGXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXAPXGGGGXXXPPXPXA 684 G G G G G PP P Sbjct: 133 PGPAGPPGTNGELGPPGDVGPPGNPGGPGLQGNHGNPAGIQGPNGLPGPNGPLGPPGPPG 192 Query: 685 T--PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP--PPXAPXXP 831 P GP Q P PG P P PP P P PP P P Sbjct: 193 DMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGP 245 Score = 40.3 bits (90), Expect = 0.002 Identities = 45/181 (24%), Positives = 47/181 (25%), Gaps = 14/181 (7%) Frame = +1 Query: 331 GPPXXRGGXGXD--------PXGXXGXXGGGGAXGXPKRXPPEXRXAP--PXPFTPRLRS 480 GPP GG G P G G G G G P PP P P P P++ Sbjct: 237 GPPGNPGGPGYQGNHGNPAGPQGPNGLPGPNGILGPP--GPPGDMGPPGLPGPPGPQMPP 294 Query: 481 RXXXXGGGXGXGXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXAPXGGGGX 660 G G G G G G Sbjct: 295 GPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGI 354 Query: 661 XXPPXPXAT--PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP--PPXAPXX 828 PP P P GP Q P PG P P PP P P PP P Sbjct: 355 NGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGG 414 Query: 829 P 831 P Sbjct: 415 P 415 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 P G G PP PG P P G PP P PP P P P P Sbjct: 597 PQGPNGQPGPPGVNGPPGEIGEIGPAGLPGPPGP---ASPPSPPGPPGPPGPKGPPGPNG 653 Query: 820 PXXPP 834 P PP Sbjct: 654 PLGPP 658 Score = 39.5 bits (88), Expect = 0.004 Identities = 47/185 (25%), Positives = 48/185 (25%), Gaps = 17/185 (9%) Frame = +1 Query: 331 GPPXXRGGXGXD-PXGXXGXXGGGGAXGXPKRX----PPEXRXAPPXPFTPRLRSRXXXX 495 GPP G G P G G G G G P PP P P P + Sbjct: 280 GPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNP 339 Query: 496 GGGXGXGXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXAPX-----GGGGX 660 G G G G AP G G Sbjct: 340 AGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGP 399 Query: 661 XXPPXPXATPGXXXGP-XXGQRPXPXG-----XXPGXPPPXXPPPPRXP-XPPXXPPPXA 819 PP PG GP G P G PG P PP P PP P P Sbjct: 400 LGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPG 459 Query: 820 PXXPP 834 P PP Sbjct: 460 PQMPP 464 Score = 39.5 bits (88), Expect = 0.004 Identities = 47/185 (25%), Positives = 48/185 (25%), Gaps = 17/185 (9%) Frame = +1 Query: 331 GPPXXRGGXGXD-PXGXXGXXGGGGAXGXPKRX----PPEXRXAPPXPFTPRLRSRXXXX 495 GPP G G P G G G G G P PP P P P + Sbjct: 365 GPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNP 424 Query: 496 GGGXGXGXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXAPXGGG-----GX 660 G G G G AP G G Sbjct: 425 AGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGP 484 Query: 661 XXPPXPXATPGXXXGP-XXGQRPXPXG-----XXPGXPPPXXPPPPRXP-XPPXXPPPXA 819 PP PG GP G P G PG P PP P PP P P Sbjct: 485 LGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPG 544 Query: 820 PXXPP 834 P PP Sbjct: 545 PQMPP 549 Score = 38.3 bits (85), Expect = 0.009 Identities = 24/64 (37%), Positives = 24/64 (37%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 P G G P P PG P P G PG P P PP P P PP P P Sbjct: 849 PAGSQGPNGQPGP---PGINGPPGQVGEMGPPGL-PGPPGPASPPSP--PGPPGPPGPKG 902 Query: 820 PXXP 831 P P Sbjct: 903 PPGP 906 Score = 37.9 bits (84), Expect = 0.011 Identities = 44/179 (24%), Positives = 47/179 (26%), Gaps = 12/179 (6%) Frame = +1 Query: 331 GPPXXRGGXGX-----DPXGXXGXXGGGGAXGX-PKRXPPEXRXAP--PXPFTPRLRSRX 486 GPP GG G +P G G G G G PP P P P P++ Sbjct: 152 GPPGNPGGPGLQGNHGNPAGIQGPNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGP 211 Query: 487 XXXGGGXGXGXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXAPXGGGGXXX 666 G G G G G G Sbjct: 212 PGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGLPGPNGILG 271 Query: 667 PPXPXAT--PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP--PPXAPXXP 831 PP P P GP Q P PG P P PP P P PP P P Sbjct: 272 PPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGP 330 Score = 37.9 bits (84), Expect = 0.011 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 1/65 (1%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP-PPRXPXPPXXPPPX 816 P G G P P PG P P G PG P P PP PP P PP P Sbjct: 764 PAGSQGPNGQPGP---PGINGPPGQVGEMGPPGL-PGPPGPASPPSPPGPPGPPGPKGPP 819 Query: 817 APXXP 831 P P Sbjct: 820 GPNGP 824 Score = 37.1 bits (82), Expect = 0.020 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPX-PPXXPPPX 816 P G G P P GP P G P P PP P+ P PP P P Sbjct: 74 PPGFQGPPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPP 133 Query: 817 APXXPP 834 P PP Sbjct: 134 GPAGPP 139 Score = 37.1 bits (82), Expect = 0.020 Identities = 43/180 (23%), Positives = 45/180 (25%), Gaps = 13/180 (7%) Frame = +1 Query: 331 GPPXXRGGXGXD--------PXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRX 486 GPP GG G P G G G G G P P P P++ Sbjct: 407 GPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGP 466 Query: 487 XXXGGGXGXGXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXAPXGGGGXXX 666 G G G G G G Sbjct: 467 PGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGING 526 Query: 667 PPXPXAT---PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP--PPXAPXXP 831 PP P PG P P P G PG P P PP P P PP P P Sbjct: 527 PPGPLGDVGPPGLPGPPGPQMPPGPPG-LPGAPGPNGPPGINGPLGPPGEAGPPGNPGGP 585 Score = 37.1 bits (82), Expect = 0.020 Identities = 47/191 (24%), Positives = 49/191 (25%), Gaps = 23/191 (12%) Frame = +1 Query: 331 GPPXXRGGXGXD-PXGXXGXXGGGGAXGXP----KRXPPEXRXAPPXPFTPRLRSRXXXX 495 GPP G G P G G G G G P PP P P P + Sbjct: 450 GPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNP 509 Query: 496 GGGXGXGXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXAPXGGG-----GX 660 G G G G AP G G Sbjct: 510 AGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGP 569 Query: 661 XXPPXPXATPGXXXGPXX-GQRPXPXGXX-----PGXPPPXXPP-------PPRXPXPPX 801 PP PG GP G P G PG P PP P P PP Sbjct: 570 LGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGVNGPPGEIGEIGPAGLPGPPG 629 Query: 802 XPPPXAPXXPP 834 P +P PP Sbjct: 630 PASPPSPPGPP 640 Score = 36.7 bits (81), Expect = 0.026 Identities = 41/161 (25%), Positives = 43/161 (26%), Gaps = 1/161 (0%) Frame = +1 Query: 319 GXGGGPPXXRGGXGXD-PXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRXXXX 495 G G P +G G P G G G G G P P +PP P P Sbjct: 674 GNHGNPAGVQGPNGQPGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGP 733 Query: 496 GGGXGXGXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXAPXGGGGXXXPPX 675 G G G G P G G PP Sbjct: 734 PGPNGPLGPPGECGPAGNAGGVGCQGHHGNPAGSQGPNGQPGPPGINGPPGQVGEMGPP- 792 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP 798 PG P P P G PG P P PP P P P Sbjct: 793 --GLPGP---PGPASPPSPPG-PPGPPGPKGPPGPNGPLGP 827 Score = 36.3 bits (80), Expect = 0.035 Identities = 43/180 (23%), Positives = 45/180 (25%), Gaps = 13/180 (7%) Frame = +1 Query: 331 GPPXXRGGXGXD--------PXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRX 486 GPP GG G P G G G G G P P P P++ Sbjct: 322 GPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGP 381 Query: 487 XXXGGGXGXGXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXAPXGGGGXXX 666 G G G G G G Sbjct: 382 PGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGING 441 Query: 667 PPXPXAT---PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP--PPXAPXXP 831 PP P PG P P P G PG P P PP P P PP P P Sbjct: 442 PPGPLGDVGPPGLPGPPGPQMPPGPPG-LPGAPGPNGPPGINGPLGPPGEAGPPGNPGGP 500 Score = 36.3 bits (80), Expect = 0.035 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 1/65 (1%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP-PPRXPXPPXXPPPX 816 P G G P P PG P P G PG P P PP PP P PP P Sbjct: 594 PAGPQGPNGQPGP---PGVNGPPGEIGEIGPAGL-PGPPGPASPPSPPGPPGPPGPKGPP 649 Query: 817 APXXP 831 P P Sbjct: 650 GPNGP 654 Score = 36.3 bits (80), Expect = 0.035 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 4/69 (5%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP-PPRXPXPP---XXP 807 P G G P P PG P P G PG P P PP PP P PP P Sbjct: 679 PAGVQGPNGQPGP---PGINGPPGQIGEMGPPGL-PGPPGPASPPSPPGPPGPPGPNGPP 734 Query: 808 PPXAPXXPP 834 P P PP Sbjct: 735 GPNGPLGPP 743 Score = 35.1 bits (77), Expect = 0.080 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 1/66 (1%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP-PPRXPXPPXXPPPX 816 P G G PP PG P PG PP PP PP P P Sbjct: 229 PLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGLPGPNGILGPPGPPGDMGPPGLPGPP 288 Query: 817 APXXPP 834 P PP Sbjct: 289 GPQMPP 294 Score = 34.7 bits (76), Expect = 0.11 Identities = 40/156 (25%), Positives = 41/156 (26%) Frame = +1 Query: 331 GPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRXXXXGGGXG 510 GPP G P G G G G G P P PP P P+ G G Sbjct: 605 GPPGVNG-----PPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPK------GPPGPNG 653 Query: 511 XGXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXAPXGGGGXXXPPXPXATP 690 G G P G G PP P Sbjct: 654 PLGPPGESGPAGNAGGVGYQGNHGNPAGVQGPNGQPGPPGINGPPGQIGEMGPP---GLP 710 Query: 691 GXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP 798 G P P P G PG P P PP P P P Sbjct: 711 GP---PGPASPPSPPG-PPGPPGPNGPPGPNGPLGP 742 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 P G P P G P P G P P P P PP P P Sbjct: 585 PGYQGNHGNPAGPQGPNGQPGPPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPG 644 Query: 820 PXXPP 834 P PP Sbjct: 645 PKGPP 649 Score = 33.9 bits (74), Expect = 0.18 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 7/72 (9%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGX-----PP--PXXPPPPRXPXPP 798 P G G P GP P PG PP P P P P PP Sbjct: 663 PAGNAGGVGYQGNHGNPAGVQGPNGQPGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPP 722 Query: 799 XXPPPXAPXXPP 834 P P P PP Sbjct: 723 GPPGPPGPNGPP 734 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPX 825 G G PP PG P P G PP PP P P P P P Sbjct: 769 GPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPG---PPGPPGPKGPPGPNGPL 825 Query: 826 XPP 834 PP Sbjct: 826 GPP 828 Score = 33.1 bits (72), Expect = 0.32 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 4/61 (6%) Frame = -1 Query: 536 PPXPWPXPXPXPPPXXXXRDLSRGVXGXGGAXRXSGGXLLGXPXAPP----PPXXPXXPX 369 PP P P P PPP D G G G G L P PP PP P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAI 88 Query: 368 G 366 G Sbjct: 89 G 89 Score = 33.1 bits (72), Expect = 0.32 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 10/66 (15%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXG--XXPGXPPPXXPP----PPRXP----XPPXXPPPX 816 PP P PG P P G PG P P PP PP P PP P P Sbjct: 38 PPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPN 97 Query: 817 APXXPP 834 PP Sbjct: 98 GVNGPP 103 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 4/68 (5%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXP----PPXXPPPPRXPXPPXXP 807 P G G P GP P PG PP P PP PP P Sbjct: 748 PAGNAGGVGCQGHHGNPAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPP 807 Query: 808 PPXAPXXP 831 P P P Sbjct: 808 GPPGPPGP 815 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 4/68 (5%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXP----PPXXPPPPRXPXPPXXP 807 P G G P GP P PG PP P PP PP P Sbjct: 833 PAGNAGGVGCQGNHGNPAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPP 892 Query: 808 PPXAPXXP 831 P P P Sbjct: 893 GPPGPPGP 900 Score = 33.1 bits (72), Expect = 0.32 Identities = 24/77 (31%), Positives = 25/77 (32%) Frame = +2 Query: 200 PXXXPXPXQXXXXXXRGLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXGGX 379 P P Q GL GP PP PP G + GP G G G G Sbjct: 862 PGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPP-GPPGPKGPPGPNGCLGPPG--DAGP 918 Query: 380 XGXXGGGGXXGXPKXXP 430 G GG G P P Sbjct: 919 AGNTGGAGCQPAPPCPP 935 Score = 31.9 bits (69), Expect = 0.74 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP----PPRXPXPPXXPPPXAPXXPP 834 PP P P GP P P G PG P P P PP P PP P P P Sbjct: 31 PPPPYEAPPPPPGP-----PGPDGP-PGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNP 84 Score = 31.1 bits (67), Expect = 1.3 Identities = 38/164 (23%), Positives = 41/164 (25%), Gaps = 10/164 (6%) Frame = -1 Query: 833 GGXXGAXG-GGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGV-----AXGX 672 G G G G G G G G G P P G GP PG G Sbjct: 337 GNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGT 396 Query: 671 GGXXXPPPPXGAXXAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPXPWPXPXPXPPPX 492 G PP G PP P P P Sbjct: 397 NGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPG 456 Query: 491 XXXRDLSRGVXGXGGAXRXSGGXLLGXPXAPP----PPXXPXXP 372 + G G GA +G + P PP PP P P Sbjct: 457 PPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGP 500 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/71 (30%), Positives = 25/71 (35%) Frame = +2 Query: 200 PXXXPXPXQXXXXXXRGLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXGGX 379 P P + GL GP PP PP G + GP G G G + G Sbjct: 607 PGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPP-GPPGPKGPPGPNGPLGPPGES--GP 663 Query: 380 XGXXGGGGXXG 412 G GG G G Sbjct: 664 AGNAGGVGYQG 674 Score = 30.7 bits (66), Expect = 1.7 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 1/72 (1%) Frame = +2 Query: 200 PXXXPXPXQXXXXXXRGLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXG-G 376 P P Q GL GP PP PP G GP G G G G Sbjct: 692 PGINGPPGQIGEMGPPGLPGPPGPASPPSPP----GPPGPPGPNGPPGPNGPLGPPGECG 747 Query: 377 XXGXXGGGGXXG 412 G GG G G Sbjct: 748 PAGNAGGVGCQG 759 Score = 30.7 bits (66), Expect = 1.7 Identities = 23/71 (32%), Positives = 24/71 (33%) Frame = +2 Query: 200 PXXXPXPXQXXXXXXRGLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXGGX 379 P P Q GL GP PP PP G + GP G G G G Sbjct: 777 PGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPP-GPPGPKGPPGPNGPLGPPGEC--GP 833 Query: 380 XGXXGGGGXXG 412 G GG G G Sbjct: 834 AGNAGGVGCQG 844 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P PP P PP PP P P P P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGP 62 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 769 PPPPRXPXPPXXPPPXAPXXPP 834 PPPP PP P P P PP Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPP 51 Score = 29.9 bits (64), Expect = 3.0 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 1/66 (1%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPG-XPPPXXPPPPRXPXPPXXPPPX 816 P G G P P PG P P G G PP P P PP Sbjct: 50 PPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNGVNGPPGELGDM 109 Query: 817 APXXPP 834 P PP Sbjct: 110 GPPGPP 115 Score = 29.9 bits (64), Expect = 3.0 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +2 Query: 248 GLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXT-XGGXXGXXGGGGXXG 412 GL GP PP PP G GP G G G G G GG G G Sbjct: 453 GLPGPPGPQMPPGPP----GLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQG 504 Score = 29.9 bits (64), Expect = 3.0 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +2 Query: 248 GLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXT-XGGXXGXXGGGGXXG 412 GL GP PP PP G GP G G G G G GG G G Sbjct: 538 GLPGPPGPQMPPGPP----GLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQG 589 Score = 29.5 bits (63), Expect = 4.0 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = -2 Query: 535 PPXXGXAPXPXPPPXTXXGT*AGG*XGXGGRTGXXGXXFWGPXXPPPPXXPXXXPXGPAX 356 P G P P G G G G G GP PP P P P P Sbjct: 72 PGPPGFQGPPGNPAGAIGPPGLPGPNGVNGPPGELGDM--GPPGPPGPPGPQMPPGPPGL 129 Query: 355 XPPSXXGAPPXFXXRXVLXGXGGGXGXGG 269 P PP G G G G Sbjct: 130 PGPPGPAGPPGTNGELGPPGDVGPPGNPG 158 Score = 28.7 bits (61), Expect = 6.9 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +1 Query: 649 GGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXX 828 GGG P T P P P P PPP P P P P P P Sbjct: 10 GGGCAAECAPACTLSCCETPPP---PPPYEAPP--PPPGPPGPDGPPGFPGPQGPNGPKG 64 Query: 829 PP 834 PP Sbjct: 65 PP 66 Score = 28.7 bits (61), Expect = 6.9 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +2 Query: 248 GLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXG-GXXGXXGGGGXXG 412 GL GP PP PP G GP G G G G G GG G G Sbjct: 198 GLPGPQGPQMPPGPP----GLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQG 249 Score = 28.7 bits (61), Expect = 6.9 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +2 Query: 248 GLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXG-GXXGXXGGGGXXG 412 GL GP PP PP G GP G G G G G GG G G Sbjct: 283 GLPGPPGPQMPPGPP----GLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQG 334 Score = 28.7 bits (61), Expect = 6.9 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +2 Query: 248 GLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXG-GXXGXXGGGGXXG 412 GL GP PP PP G GP G G G G G GG G G Sbjct: 368 GLPGPPGPQMPPGPP----GLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQG 419 Score = 28.3 bits (60), Expect = 9.2 Identities = 23/70 (32%), Positives = 25/70 (35%), Gaps = 6/70 (8%) Frame = -1 Query: 830 GXXGAXG-GGXXGGXGXRGGGGXXGG-----GXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 G G G G GG G +G G G G PG P G P + P G Sbjct: 826 GPPGECGPAGNAGGVGCQGNHGNPAGSQGPNGQPG--PPGINGPPGQVGEMGPPGLPGPP 883 Query: 668 GXXXPPPPXG 639 G PP P G Sbjct: 884 GPASPPSPPG 893 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 42.7 bits (96), Expect = 4e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP PPPP P P PPP P PP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PPP PPPP P PP P P P PP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +1 Query: 649 GGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 GGG P P P P P PPP PPPP+ PP PP P Sbjct: 658 GGGQTISVNPSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P PPP P P P PP PP P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 32.3 bits (70), Expect = 0.56 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P+ PP PP Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P T P P P P P PPPP P P +P P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/49 (28%), Positives = 15/49 (30%) Frame = +3 Query: 270 PPXPXPPPXPXKTKRXXKXGGAPXXEGGXXAGPXGXXXGXXGGGGXXGP 416 PP P PPP T P + G P G G G P Sbjct: 693 PPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQP 741 Score = 29.1 bits (62), Expect = 5.2 Identities = 34/150 (22%), Positives = 38/150 (25%), Gaps = 2/150 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGG-GGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXX 657 GG G GG GG G GG GG G G G G + G Sbjct: 597 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGN--SGGSNSHSGEVT 654 Query: 656 PPPPXGAXXAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPXPWPX-PXPXPPPXXXXR 480 P G + PP P P P PPP Sbjct: 655 IQPGGGQTISVNPSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Query: 479 DLSRGVXGXGGAXRXSGGXLLGXPXAPPPP 390 + + G G G P PPP Sbjct: 715 PVQQS-GAPGSPAGSPSGTSAGNPQQQPPP 743 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P + PP PPP P PP Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPP 696 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 403 PPPPXXPXXXPXGPAXXPPSXXGAPP 326 PPPP P P P PP PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPP-SXXGAP 329 P PPPP P P P PP GAP Sbjct: 694 PPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP 789 PP P P G P G G P PPP + P Sbjct: 708 PPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPPPGQLP 748 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPX 816 AP GG PP AT G P P P P PPP PP PPP Sbjct: 145 APATGGPPPPPPIAPATGGPPPPPPIA--PAATVPAPAVPLAAASPPPPSGGPPPPPPPP 202 Query: 817 APXXPP 834 P PP Sbjct: 203 PPPPPP 208 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = +1 Query: 637 APXGGGGXXXPPX-PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 AP GG PP P AT P P P P PPP PPPP P PP Sbjct: 158 APATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPP 217 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/62 (35%), Positives = 23/62 (37%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPX 816 AP PP P +P P P P G PPP P P PP PPP Sbjct: 116 APETPSQAPSPPPPPTSPATRAPPP----PPPIAPATGGPPPPPPIAPATGGPP-PPPPI 170 Query: 817 AP 822 AP Sbjct: 171 AP 172 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP----PPPRXPXPPXXPPPXAPXXPP 834 PP P P GP P P PPP P P P P PPP + PP Sbjct: 139 PPPPPIAPATG-GPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPP 197 Score = 33.1 bits (72), Expect = 0.32 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP--PRXPXPPXXPPPXAP 822 P P P P P P P P PPP P PP PPP AP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPP-PPPPIAP 159 Score = 31.9 bits (69), Expect = 0.74 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPX-PXGXXPGXPPPXXPP---PPRXPXPPXXPPPXAPXXPP 834 PP P A P P P P PPP P PP P PP P P PP Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPP--PPPPIAPATGGPPPPP 168 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/55 (30%), Positives = 20/55 (36%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P A+ P + P P P PPPPR P P P +P PP Sbjct: 78 PQTQASTAPPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAP--SPPPPP 130 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 270 PPXPXPPPXPXKTKRXXKXGGAPXXEGGXXAGPXGXXXGXXGGGG 404 PP P PPP P + P A G G GGGG Sbjct: 195 PPPPPPPPPPPPPPPILELAAPPPPGSVLGAALTGIKSGVVGGGG 239 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P Q P P P P P PP P AP PP Sbjct: 87 PLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPP 142 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 14/46 (30%), Positives = 16/46 (34%) Frame = -2 Query: 415 GPXXPPPPXXPXXXPXGPAXXPPSXXGAPPXFXXRXVLXGXGGGXG 278 GP PPPP P P P G+ + G GG G Sbjct: 194 GPPPPPPPPPPPPPPPILELAAPPPPGSVLGAALTGIKSGVVGGGG 239 Score = 23.8 bits (49), Expect(2) = 1.3 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -2 Query: 535 PPXXGXAPXPXPPP 494 PP G P P PPP Sbjct: 189 PPPSGGPPPPPPPP 202 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG G GGGG GGG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 37.1 bits (82), Expect = 0.020 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 + GGG G GGG G GG G GGGG G Sbjct: 130 DDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 37.1 bits (82), Expect = 0.020 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 + GGG G GGG G GG G GGGG G Sbjct: 131 DGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXP-GXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P A G GP GQ P G P G PPP PP P PP P P PP Sbjct: 189 PPAGVGQHSGPYPGQ-PGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P G G P P PG P G P P G PG PP PPPP P PPP Sbjct: 189 PPAGVGQHSGPYP-GQPGMWGPPPMGG-PPPMGGPPGGYPP--PPPPPGAGDPAYPPP 242 Score = 29.9 bits (64), Expect = 3.0 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -1 Query: 776 GGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXPPPPXGA 636 G G G PG P G P GP P + GG PPPP GA Sbjct: 192 GVGQHSGPYPGQ-PGMWGPPPMGGP---PPMGGPPGGYPPPPPPPGA 234 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGV-AXGXGG 666 GG G GG GG G GGGG GG G G G G GV A G GG Sbjct: 279 GGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGG 335 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXL-XPGVAXGXGG 666 GG G GG GG G GGGG GG G G G G G A G GG Sbjct: 244 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 300 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXL-XPGVAXGXGG 666 GG G GG GG G GGGG GG G G G G G A G GG Sbjct: 251 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 307 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXL-XPGVAXGXGG 666 GG G GG GG G GGGG GG G G G G G A G GG Sbjct: 265 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGG 321 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG G GGGG GG G G G G G GG Sbjct: 272 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGG 327 Score = 36.7 bits (81), Expect = 0.026 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG G GGG GG G G G G G G GG Sbjct: 307 GGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGG 362 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G T GG GGGG G Sbjct: 244 GGATGGGGGATGGGGGATGGGGGATGGGGGATG 276 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G T GG GGGG G Sbjct: 251 GGATGGGGGATGGGGGATGGGGGATGGGGGATG 283 Score = 35.9 bits (79), Expect = 0.046 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGG-XXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG G GGGG GGG G G G A G GG Sbjct: 258 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGG 314 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G T GG GGGG G Sbjct: 258 GGATGGGGGATGGGGGATGGGGGATGGGGGATG 290 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G T GG GGGG G Sbjct: 265 GGATGGGGGATGGGGGATGGGGGATGGGGGATG 297 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G T GG GGGG G Sbjct: 272 GGATGGGGGATGGGGGATGGGGGATGGGGGATG 304 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G T GG GGGG G Sbjct: 279 GGATGGGGGATGGGGGATGGGGGATGGGGGATG 311 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G T GG GGGG G Sbjct: 314 GGATGGGGGATGGGVGATGGGGGATGGGGGVTG 346 Score = 35.5 bits (78), Expect = 0.060 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG G G GGGG GG G G G G GV G GG Sbjct: 300 GGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGG-----GVTGGGGG 350 Score = 35.1 bits (77), Expect = 0.080 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -1 Query: 833 GGXXGAXGGGXX---GGXGXRGGGGXXGGGXPGXXPXGXG 723 GG GA GGG GG G GGGG GG G G G Sbjct: 325 GGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G T GG GGGG G Sbjct: 321 GGATGGGVGATGGGGGATGGGGGVTGGGGGATG 353 Score = 34.3 bits (75), Expect = 0.14 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = -1 Query: 833 GGXXGAXGGGXX----GGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GA GGG GG GGGG GGG G G G A G GG Sbjct: 297 GGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGG 356 Score = 33.1 bits (72), Expect = 0.32 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GGG GGG G T GG GGGG Sbjct: 332 GGGGGATGGGGGVTGGGGGATGGGGG 357 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG GGG G T GG GGGG G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATG 269 Score = 32.3 bits (70), Expect = 0.56 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG GG G GGG G G G G G G GG Sbjct: 285 GGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGG 340 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G T GG GGG G Sbjct: 286 GGATGGGGGATGGGGGATGGGGGATGVGGGATG 318 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G T G GGGG G Sbjct: 293 GGATGGGGGATGGGGGATGVGGGATGGGGGATG 325 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G GGG G T GG GGGG G Sbjct: 307 GGATGVGGGATGGGGGATGGGVGATGGGGGATG 339 Score = 31.9 bits (69), Expect = 0.74 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G G GG GGGG GGG G G G A G GG Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 293 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GGG GG G GG G G Sbjct: 334 GGGATGGGGGVTGGGGGATGGGGGPGSGG 362 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G T GG GG G G Sbjct: 335 GGATGGGGGVTGGGGGATGGGGGPGSGGCGEDG 367 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGG--GGXXG 412 GGG G GGG GG G GG GG G Sbjct: 292 GGGATGGGGGATGGGGGATGVGGGATGGGGG 322 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P PG P P P G PPP PPPP P PPP Sbjct: 713 PPPPPPPPGCAGLPPPPPSPQPG--CAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXG--PXXGQRPXPXGXXPGXPPPXXPPPPRX---PXPPXXPPPXAPXXP 831 PP P P G P P P G PPP P P P PP PPP P Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLP 754 Query: 832 P 834 P Sbjct: 755 P 755 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +1 Query: 649 GGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXX 828 G PP P P P P PG PPP P PPP P Sbjct: 688 GSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Query: 829 P 831 P Sbjct: 748 P 748 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 7/44 (15%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPP-------RXPXPPXXPPPXAPXXPP 834 P G PPP PPPP P PP PPP PP Sbjct: 684 PVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPP 727 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP-----RXPXPPXXPPPXAPXXP 831 PP P P P P P P PPPP P PP P P P Sbjct: 681 PPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLP 740 Query: 832 P 834 P Sbjct: 741 P 741 Score = 29.9 bits (64), Expect = 3.0 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP 798 P G PP P PG P P P G PPP PPP P P Sbjct: 718 PPPGCAGLPPPPPSPQPGCAGLPP--PPPPPPPGCAGLPPP--PPPIDVPMKP 766 Score = 29.5 bits (63), Expect = 4.0 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +1 Query: 667 PPXPXATP---GXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P P G P P G P PPPP P PPP P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +1 Query: 682 ATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP--PXAPXXPP 834 ATP GP P P G G PPP PP P PP PP AP PP Sbjct: 654 ATP--EAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 37.1 bits (82), Expect = 0.020 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP 810 PP P PG G G P P PG P PPP PP PP Sbjct: 661 PPPPPPPPGGQAG---GAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 403 PPPPXXPXXXPXGPAXXPPSXXGAPP 326 PPPP P P PP GAPP Sbjct: 676 PPPPPPPLPGGAAPPPPPPIGGGAPP 701 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXA--TPGXXXGPXXGQRPXPXGXXPGXPPPXXP-PPPRXPXPPXXPPPXAPXXPP 834 PP P P +P P P PP P PPPR P PP P P PP Sbjct: 1019 PPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPP 1077 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP + P P Q P P P PP P P P P PPP P P Sbjct: 1058 PPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTP 1113 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P PP PPPR P PP P P P Sbjct: 1036 PSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQP 1091 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/66 (33%), Positives = 26/66 (39%), Gaps = 2/66 (3%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP-PPPRXP-XPPXXPPP 813 P G PP A+P ++P P PPP P PPP P PP PPP Sbjct: 1019 PPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPP 1078 Query: 814 XAPXXP 831 + P Sbjct: 1079 PSTSQP 1084 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP--RXPXPPXXPPPXAPXXP 831 PP + P ++P P P PPP PPPP P PP P P P Sbjct: 1043 PPRKPSPPPSAVPIPPPRKPSPPPSEPA-PPPRQPPPPSTSQPVPPPRQPDPIPTNP 1098 Score = 31.5 bits (68), Expect = 0.98 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPP--PXXP--PPPRXPXPPXXPPP 813 PP A P P +P P P P P P PPPR P P P P Sbjct: 1065 PPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRP 1117 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 P G PP A P P G P P G PP PP P P PP Sbjct: 347 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPG 406 Query: 820 PXXP 831 P P Sbjct: 407 PMIP 410 Score = 37.1 bits (82), Expect = 0.020 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 P G P A P P P G P PPP PP P PPP Sbjct: 340 PPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPG 399 Query: 820 PXXPP 834 PP Sbjct: 400 RGAPP 404 Score = 36.7 bits (81), Expect = 0.026 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 6/62 (9%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXP--GXPPPXXP----PPPRXPXPPXXPPPXAPXX 828 PP P + G P G P P P G PPP P PP PP PPP Sbjct: 346 PPPP--SMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAP 403 Query: 829 PP 834 PP Sbjct: 404 PP 405 Score = 36.3 bits (80), Expect = 0.035 Identities = 21/69 (30%), Positives = 22/69 (31%) Frame = +1 Query: 628 AXXAPXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP 807 A P G PP P + P P P PP PP P PP Sbjct: 314 APPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGG 373 Query: 808 PPXAPXXPP 834 PP P PP Sbjct: 374 PP--PPPPP 380 Score = 35.5 bits (78), Expect = 0.060 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP-----XXPPPPRXPXPPXXPPPXAPXXP 831 PP P + P G P P PPP PPPP PPP + P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAP 346 Query: 832 P 834 P Sbjct: 347 P 347 Score = 33.5 bits (73), Expect = 0.24 Identities = 25/72 (34%), Positives = 26/72 (36%), Gaps = 7/72 (9%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP----RXPXPP--- 798 P G PP A P P G P P G PP PPPP + P PP Sbjct: 290 PPSRGAAPPPPSRGAPPPP---PSRGSAPPPPPARMGTAPP--PPPPSRSSQRPPPPSRG 344 Query: 799 XXPPPXAPXXPP 834 PPP PP Sbjct: 345 APPPPSMGMAPP 356 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPX---XPPPPRXPXPPXXPPPXAPXXPP 834 Q P P PPP PPPP P PP PP Sbjct: 286 QPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPP 327 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = -2 Query: 415 GPXXPPPPXX--PXXXPXGPAXXPPSXXGAPP 326 GP PPPP P P PP GAPP Sbjct: 373 GPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPP 404 Score = 28.7 bits (61), Expect = 6.9 Identities = 21/74 (28%), Positives = 22/74 (29%), Gaps = 4/74 (5%) Frame = -2 Query: 535 PPXXGXAPXPX----PPPXTXXGT*AGG*XGXGGRTGXXGXXFWGPXXPPPPXXPXXXPX 368 PP G AP P PPP G+ G PPPP P Sbjct: 290 PPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Query: 367 GPAXXPPSXXGAPP 326 PP GA P Sbjct: 350 SMGMAPPPVGGAAP 363 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/48 (39%), Positives = 21/48 (43%) Frame = +1 Query: 691 GXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G G +RP P P PPP PPPP P PP PP + P Sbjct: 849 GRGRGRSRYRRPRPR---PRRPPPPPPPPPPPPPPPPPPPASSTGSTP 893 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 702 RXRXXPTARXXGXXPRXPPPXXPPPPPXPXPP 797 R R R PR PPP PPPPP P PP Sbjct: 850 RGRGRSRYRRPRPRPRRPPPPPPPPPPPPPPP 881 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 721 RPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 RP P PPP PPPP P P P Sbjct: 863 RPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVP 899 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPP-SXXGAPP 326 P PPPP P P P PP S G+ P Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPPASSTGSTP 893 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG G GGGG G G G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGG 98 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GGG GG G GGGG GGG G G G G G G GG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG GGGG GGG G G G Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG G G GG G GGGG GGG G G GR Sbjct: 78 GGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGR 115 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRG-GGGXXGGGXPGXXPXGXG 723 GG G GGG GG G G GGG GGG G G G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGG 105 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG G GG GGG G G G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG G G G GG GGG G G G Sbjct: 73 GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 36.3 bits (80), Expect = 0.035 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GGG GG G GGGG GGG G G G G G GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 36.3 bits (80), Expect = 0.035 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG G G GGG GGG G G G Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 36.3 bits (80), Expect = 0.035 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG G G GGG GGG G G G Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 35.1 bits (77), Expect = 0.080 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G G G GGGG G Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGG 99 Score = 35.1 bits (77), Expect = 0.080 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G G G GGGG G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 35.1 bits (77), Expect = 0.080 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG GG G GGGG G Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDG 102 Score = 35.1 bits (77), Expect = 0.080 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG GG G GGGG G Sbjct: 77 GGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG GGGG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGG 94 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGG 95 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GGGG G Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGG 103 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 G G GG GG G GGGG GGG G G Sbjct: 86 GDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRW 717 GG G GGG GG G GGG GGG G G R+ Sbjct: 82 GGDDGDGGGGDGGGGG--GGGDGGGGGGGGGGGVGRARF 118 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G + G G G GGG G G G GGGG G Sbjct: 82 GGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXG 411 G G GGG GG G G G GGGG G Sbjct: 76 GGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G G G GGG G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGG 98 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 + GGG G GGG G GG G G G G Sbjct: 61 DGGGGGGGGGGGGGGGGGGGGGGDDGDGGGG 91 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G GG G GGG G Sbjct: 75 GGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG--XPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG GG G GGGG GGG G G G G G G GG Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGG 1814 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG G GGGG GGG G G G G G G GG Sbjct: 1789 GGEFG--GGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGG 1842 Score = 33.5 bits (73), Expect = 0.24 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG G GGG GGG G G G G G GG Sbjct: 1764 GGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGG 1819 Score = 32.3 bits (70), Expect = 0.56 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG G GGG G GG G GGGG Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGG--GGMGGGG 1784 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GG GG G GG G G G G G Sbjct: 1808 GGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGG 1844 Score = 31.5 bits (68), Expect = 0.98 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRG--GGGXXGGGXPGXXPXGXG 723 GG G GGG GG G GGG GG G G G Sbjct: 1807 GGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G E GGG GGG GG G GG G G Sbjct: 1789 GGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGG 1821 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GGG G GG G GG G Sbjct: 1800 GGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMG 1832 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 314 GXEXGGGPXGXGG--GXGXTXGGXXGXXGGGGXXG 412 G GGG G G G G GG G GGGG G Sbjct: 1784 GMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMG 1818 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG G GGG G GG G GGGG G Sbjct: 1756 GGFGGGGGGGG--MGGGGGMAGGGGGMG 1781 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 332 GPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G GGG G GG GGGG G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGG 1782 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G G G G GG G Sbjct: 1807 GGGMGGGGGGMGGG-GEGMGAAGGGMGAGGEGG 1838 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G G G G GG GGG G Sbjct: 1814 GGGMGGGGEGMGAAGGGMGAGGEGGGAGG 1842 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G G G GGG G Sbjct: 1814 GGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G GGG GG G GGGG GGG G G G Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG G GGGG GGG G G G Sbjct: 81 GGRGGGFGGG--GGFGGGGGGGFGGGGGGGFGGGGGG 115 Score = 37.1 bits (82), Expect = 0.020 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGG 117 Score = 36.7 bits (81), Expect = 0.026 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXR--GGGGXXGGGXPGXXPXGXG 723 GG G GGG GG G GGGG GGG G G G Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G GGG GG G G GG GGG G G G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGG 118 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG G GGG G GG G GGGG G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGG 111 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G GG G GGGG G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGG 116 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GG G G Sbjct: 91 GGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG GG G GGGG G Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GG G GGG G GG G GGGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGG 106 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G GG G G GG G Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 29.1 bits (62), Expect = 5.2 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -1 Query: 809 GGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GG G GGG GGG G G G G G G GG Sbjct: 81 GGRGGGFG---GGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXP 747 GG GGG GG G GGGG P Sbjct: 105 GGGGFGGGGGGGGGFGGGGGGGFGSRARP 133 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG GGG GG G GGGG GGG G G G Sbjct: 192 GGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 G G GGG GG G GG G GGG G G GR Sbjct: 187 GGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGR 223 Score = 36.3 bits (80), Expect = 0.035 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG-RWPXXGPXLXPGVAXGXGG 666 G G GGG GG G R GGG GGG G G G R G G G GG Sbjct: 126 GRRGGGYGGGRGGGGGYRSGGGYRGGG--GYRGGGGGYRGRGRGGGGYGGGGYGGGG 180 Score = 35.9 bits (79), Expect = 0.046 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GG G G GGGG GGG G G G G G G G Sbjct: 159 GGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGG 213 Score = 35.9 bits (79), Expect = 0.046 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG GG G GGG GGG G G G G G G GG Sbjct: 165 GRGGGGYGGGGYGGGGY--GGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGG 218 Score = 34.7 bits (76), Expect = 0.11 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGG---GXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG GG G GGG G GGG G G G G G G GG Sbjct: 170 GYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G + G G GGGG G Sbjct: 189 GGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG G G RGGGG GGG G G G G G G GG Sbjct: 150 GGGGYRGGGGGYRGRG-RGGGGYGGGGYGGGGYGGGGH--GGGGYGGGGYGGGGGG 202 Score = 32.3 bits (70), Expect = 0.56 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GGG G G RGGGG GG G G G G G G G Sbjct: 133 GGGRGG-GGGYRSGGGYRGGGGYR-GGGGGYRGRGRGGGGYGGGGYGGGGYGGGG 185 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GG G G Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGG 210 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG GGGG G Sbjct: 173 GGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGG 205 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G G G G GGGG G Sbjct: 184 GGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGG 216 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G G G G GGG G GG G GGG Sbjct: 198 GGGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 G G GGG GG G GGG GGG G Sbjct: 123 GGGGRRGGGYGGGRGG-GGGYRSGGGYRG 150 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPX-GXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 125 GGRRGGGYGGGRGGGGGYRSGG--GYRGGGGYRG 156 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GGGG G Sbjct: 163 GRGRGGGGYGGGGYGGGGYGG--GGHGGGGYGG 193 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GGGG G Sbjct: 168 GGGYGGGGYGGGGYGGGGHGG--GGYGGGGYGG 198 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 A + GGG GGG G GG G GGG G Sbjct: 118 ASKDSGGGGR-RGGGYGGGRGGGGGYRSGGGYRG 150 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGXGGG-XGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 147 GYRGGGGYRGGGGGYRGRGRGG--GGYGGGGYGG 178 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 38.7 bits (86), Expect = 0.006 Identities = 25/68 (36%), Positives = 25/68 (36%), Gaps = 8/68 (11%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXX---GQRPXPXGXXPGXPPP-----XXPPPPRXPXP 795 P G G PP P A G P G P P G G PPP PPPP Sbjct: 538 PPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQG 597 Query: 796 PXXPPPXA 819 PPP A Sbjct: 598 GGPPPPGA 605 Score = 35.5 bits (78), Expect = 0.060 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 10/70 (14%) Frame = +1 Query: 640 PXGGGGXXXPPXPXA-----TPGXXXGPXXGQRPXPXGXXPGXPPP-----XXPPPPRXP 789 P G G PP P A P G GQ P G G PPP PPPP Sbjct: 494 PPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAG 553 Query: 790 XPPXXPPPXA 819 PPP A Sbjct: 554 QGWGQPPPGA 563 Score = 34.3 bits (75), Expect = 0.14 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 9/69 (13%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQ--RPXPXGXXP--GXPPP-----XXPPPPRXPX 792 P GG G PP G P GQ P P G G PPP PPPP Sbjct: 484 PGGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQ 543 Query: 793 PPXXPPPXA 819 PPP A Sbjct: 544 GGGPPPPGA 552 Score = 32.7 bits (71), Expect = 0.43 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 10/70 (14%) Frame = +1 Query: 640 PXGGGGXXXPPXPXA-----TPGXXXGPXXGQRPXPXGXXPGXPPP-----XXPPPPRXP 789 P G G PP P A P G GQ P G G PPP PPP Sbjct: 527 PPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQ 586 Query: 790 XPPXXPPPXA 819 P PPP A Sbjct: 587 EGP--PPPGA 594 Score = 31.5 bits (68), Expect = 0.98 Identities = 24/75 (32%), Positives = 24/75 (32%), Gaps = 10/75 (13%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXX----GQRPXPXGXXPGXPPPXXP------PPPRXP 789 P G G PP P A G P G P P G PPP PPP Sbjct: 505 PPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAG 564 Query: 790 XPPXXPPPXAPXXPP 834 PPP A P Sbjct: 565 QGGGPPPPGAGQGGP 579 Score = 31.1 bits (67), Expect = 1.3 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 9/74 (12%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQ--RPXPXGXXP--GXPPP-----XXPPPPRXPX 792 P G G PP G P GQ P P G G PPP PPPP Sbjct: 517 PGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQ 576 Query: 793 PPXXPPPXAPXXPP 834 PP PP Sbjct: 577 GGPPPPGAGQEGPP 590 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP 654 GG G G GG G G G PG G P G P G P Sbjct: 500 GGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQP 559 Query: 653 PPPXG 639 PP G Sbjct: 560 PPGAG 564 Score = 30.3 bits (65), Expect(2) = 0.014 Identities = 26/84 (30%), Positives = 28/84 (33%), Gaps = 9/84 (10%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXG------GGGAXGXPKRXPPEXRXAPPXPFTPRL 474 G G GGGPP G G P G G G G P PP P + Sbjct: 496 GAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQG 555 Query: 475 RSRXXXXGGGXGXG---XGXGXGG 537 + G G G G G G GG Sbjct: 556 WGQ-PPPGAGQGGGPPPPGAGQGG 578 Score = 30.3 bits (65), Expect = 2.3 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP 654 GG G G GG G G G PG G P G P G G P Sbjct: 533 GGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEG---P 589 Query: 653 PPP 645 PPP Sbjct: 590 PPP 592 Score = 29.9 bits (64), Expect = 3.0 Identities = 24/72 (33%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = +1 Query: 313 GXGXGGGPPX-XRG-GXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRX 486 G G GGGPP G G G P G G GG G + PP P P Sbjct: 540 GAGQGGGPPPPGAGQGWGQPPPG-AGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGG 598 Query: 487 XXXGGGXGXGXG 522 G G G G Sbjct: 599 GPPPPGAGQGWG 610 Score = 29.5 bits (63), Expect = 4.0 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXP-GXXPXGXGRWPXXGPXLXPGVAXGXGGXXXPPPP 645 G GG G G GG G G G P G G+ GP PG G G PPP Sbjct: 498 GQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQ--GGGPP-PPGAGQGGG-----PPP 549 Query: 644 XGA 636 GA Sbjct: 550 PGA 552 Score = 29.1 bits (62), Expect = 5.2 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR-W--PXXGPXLXPGVAXGXGGXXXPPPP 645 G G GG G G GGG P P G G+ W P G G G PPPP Sbjct: 529 GAGQGGGPPPPGAG--QGGGPP---PPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPP 582 Score = 28.3 bits (60), Expect = 9.2 Identities = 26/86 (30%), Positives = 28/86 (32%), Gaps = 8/86 (9%) Frame = +1 Query: 304 KXSGXGXG-GGPPXXRGGXGXDPXGXXGXXGG----GGAXGXPKRXPPEXRXAPPXPFTP 468 K G G G G PP G G P G GG G G + P + P P Sbjct: 482 KVPGGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGA 541 Query: 469 RLRSRXXXXGGGXGXG---XGXGXGG 537 G G G G G G GG Sbjct: 542 GQGGGPPPPGAGQGWGQPPPGAGQGG 567 Score = 26.2 bits (55), Expect(2) = 0.014 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +1 Query: 640 PXGGGGXXXPPXPXA----TPGXXXGPXXGQRPXPXGXXPGXPPP 762 P G G PP P A P G G P G G PPP Sbjct: 570 PPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPP 614 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +1 Query: 721 RPXPXGXXPGXPPPXXPPPPRXP--XPPXXPPPXAPXXPP 834 +P P P PPP PPPP P PP PPP PP Sbjct: 187 KPSPMAGMPPPPPP--PPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 415 GPXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 G PPPP P P G PP GAPP Sbjct: 193 GMPPPPPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 688 PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP 798 P G P P PG PP PPP P PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 P G P P P P PPPP P P PPP A Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPP--PPPFGAPPPPA 225 Score = 29.1 bits (62), Expect(2) = 0.95 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGP-----AXXPPSXXGAPP 326 P PPPP P P P A PP+ G PP Sbjct: 198 PPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 422 LLGXPXAPPPPXXPXXPXGSXP 357 + G P PPPP P P G+ P Sbjct: 191 MAGMPPPPPPPPPPGFPGGAPP 212 Score = 21.0 bits (42), Expect(2) = 0.95 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -2 Query: 532 PXXGXAPXPXPPP 494 P G P P PPP Sbjct: 190 PMAGMPPPPPPPP 202 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 38.3 bits (85), Expect = 0.009 Identities = 24/71 (33%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = +1 Query: 628 AXXAPXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP---XPP 798 A +P G PP + P P G P P G P PPP PP P PP Sbjct: 2157 ARHSPSGPSPLGAPP---SVPPPMGAPPSG--PPPMGAPPSGPPPMGTPPSGHPPMGAPP 2211 Query: 799 XXPPPXAPXXP 831 PPP P Sbjct: 2212 MGPPPSGSHSP 2222 Score = 34.7 bits (76), Expect = 0.11 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = +1 Query: 628 AXXAPXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP---XPP 798 A P G PP P G G P P G P PPP PP P PP Sbjct: 2137 AMGPPPMGSSRYGPPPPM---GPARHSPSG--PSPLGAPPSVPPPMGAPPSGPPPMGAPP 2191 Query: 799 XXPPP 813 PPP Sbjct: 2192 SGPPP 2196 Score = 32.7 bits (71), Expect = 0.43 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 3/58 (5%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQ-RPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA--PXXPP 834 P P + P G R P G P PP PPP PP PPP P PP Sbjct: 2140 PPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPP--MGAPPSGPPPMGAPPSGPP 2195 Score = 32.3 bits (70), Expect = 0.56 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXP---XPPXXPPPXA--PXXPP 834 P P G P PPP PP P PP PP P PP Sbjct: 2174 PPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPP 2215 Score = 29.9 bits (64), Expect = 3.0 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 3/64 (4%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP---PPRXPXPPXXPP 810 P G PP GP P G PP PP PP P P PP Sbjct: 2142 PMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPP 2201 Query: 811 PXAP 822 P Sbjct: 2202 SGHP 2205 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPP----PXXPPPPRXPXPPXXP 807 P G G PP P + PG P P PP P PPP P P Sbjct: 377 PGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQP 436 Query: 808 PPXAP 822 PP P Sbjct: 437 PPPPP 441 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRX-PXPPXXPPP---XAPXXPP 834 G RP G PG PPP P P PP PP AP PP Sbjct: 373 GMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPP 416 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 691 GXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 G P P P PP PPPP+ P PPP P Sbjct: 302 GVGEAPPPPAASEPAAFAPAPPPSQAPPPPK-TIPSTLPPPPVP 344 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPX--PXGXXPGXPPPXXPPPPRXP-XPPXXPPPXAPXXPP 834 P PG GP P P G PG PPP P P PP P PP Sbjct: 371 PPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPP 428 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P AT P P P PP PP P PPP Sbjct: 341 PPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPPGAGNGPGGPPPP 389 Score = 29.5 bits (63), Expect = 4.0 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPX 816 A G G PP P Q P P P P PPPP P PPP Sbjct: 299 AELGVGEAPPPPAASEPAAFAPAPPPSQAPPP----PKTIPSTLPPPP-VPSATSAPPPW 353 Query: 817 A 819 A Sbjct: 354 A 354 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P G P P P P P PPPP P PP P P PP Sbjct: 125 PPTGTLPPPPVTPP--PGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 37.1 bits (82), Expect = 0.020 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPP-PRXPXPPXXPPPXAP 822 P P G P PPP PPP P P PP P P P Sbjct: 124 PPPTGTLP--PPPVTPPPGPETPPPPDTPAPPVP 155 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 736 GXXPGXPPPXX-PPPPRXPXP-PXXPPPXAPXXPP 834 G P PP PPPP P P P PPP PP Sbjct: 119 GYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPP 153 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +1 Query: 652 GGXXXPPXPXAT-PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP 789 GG PP P T P P G P P P P PP P Sbjct: 118 GGYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAP 164 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 403 PPPPXXPXXXPXGPAXXPPSXXGAPP 326 PPPP P P GP PP APP Sbjct: 131 PPPPVTP---PPGPETPPPPDTPAPP 153 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 37.9 bits (84), Expect = 0.011 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = -1 Query: 833 GGXXGAXGGG-XXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXL-XPGVAXGXGG 666 GG GA GGG GG G GGGG GG G G G G G A G GG Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGG 108 Score = 36.7 bits (81), Expect = 0.026 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG G GGGG GG G G G G G G GG Sbjct: 87 GGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHG-----GATGGHGG 137 Score = 36.3 bits (80), Expect = 0.035 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = -1 Query: 833 GGXXGAXGGGXX--GGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GA GGG GG GGGG GGG G G G A G GG Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGG 101 Score = 35.1 bits (77), Expect = 0.080 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXL-XPGVAXGXGG 666 GG G GG GG G GGG GGG G G G G G A G GG Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGG--GATGGGGGATGGHGGATGGGGGATGDGG 94 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GG GG G GGGG GG G Sbjct: 136 GGATGGHGGATGGGGGATGGGGGATGGGGG 165 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GG G G GGGG GG G G G Sbjct: 129 GGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGG 165 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G T GG GGGG G Sbjct: 80 GGATGGGGGATGDGGGATGGGGGATGGGGGATG 112 Score = 33.1 bits (72), Expect = 0.32 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG G GG GG G GGGG GG Sbjct: 143 GGATGGGGGATGGGGGATGGGGGATGG 169 Score = 32.7 bits (71), Expect = 0.43 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG GGG G T GG G GGGG Sbjct: 59 GGATGGGGGATGGGGGAT-GGHGGATGGGG 87 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG GGG G T GG GGGG G Sbjct: 136 GGATGGHGGATGGGGGATGGGGGATGGGGGATG 168 Score = 32.3 bits (70), Expect = 0.56 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG GG G GGG G G G G G G GG Sbjct: 65 GGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGG 120 Score = 32.3 bits (70), Expect = 0.56 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = -1 Query: 833 GGXXGAXGGGXX----GGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GA GGG GG GGGG GGG G G G G G GG Sbjct: 77 GGHGGATGGGGGATGDGGGATGGGGGATGGG--GGATGGHGGATGGGVGATGGHGGATGG 134 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG GGG G T GG G GGGG G Sbjct: 40 GGATGGHGGATGGGGGATGGGATG--GGGGATG 70 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGG 400 G GGG GGG G T GG G GGG Sbjct: 94 GGATGGGGGATGGGGGAT-GGHGGATGGG 121 Score = 30.3 bits (65), Expect = 2.3 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G GGG G G G G G G A G GG Sbjct: 101 GGATGG-GGGATGGHGGATGGGVGATGGHGGATGGHG-----GATGGHGGATGGGG 150 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GG G T GG GGG G Sbjct: 66 GGATGGGGGATGGHGGATGGGGGATGDGGGATG 98 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG GGG G T G GGGG G Sbjct: 73 GGATGGHGGATGGGGGATGDGGGATGGGGGATG 105 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GGG GG G GGGG G Sbjct: 65 GGGATGGGGGATGGHGGATG--GGGGATG 91 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GG G T GG GGGG G Sbjct: 47 GGATGGGGGATGG--GATGGGGGATGGGGGATG 77 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGG--GGXXG 412 GGG G GGG GG G GG GG G Sbjct: 93 GGGATGGGGGATGGGGGATGGHGGATGGGVG 123 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P + P G P P G P PP P P P PP PPP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXP-PPXXPPPPRXPXPPXXPPP 813 PP P T G P G P P P P P PP P PP P Sbjct: 281 PPPPPLTGGMLPPPFGGH---PAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP 810 PP P G P G P P P PPP P P P Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 403 PPPPXXPXXXPXGPAXXPPSXXGAP 329 PPPP P P P PP G P Sbjct: 303 PPPPPLPAGVPAPPPPPPPPMLGGP 327 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG GGG GG G GGG GGG G G G Sbjct: 169 GGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGG 205 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG G GGG GG G GG GGG G G Sbjct: 181 GGDGGDDGGG-SGGGGDDGGSDGGGGGNDGGRDDG 214 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +2 Query: 326 GGGPXGXGGGX-GXTXGGXXGXXGGGGXXG 412 GGG G GGG G G G GGGG G Sbjct: 169 GGGSNGSGGGDDGGDGGDDGGGSGGGGDDG 198 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = -1 Query: 833 GGXXGAXGG--GXXGGX--GXRGGGGXXGGGXPGXXPXGXGR 720 GG G+ GG G GG G GGGG GG G GR Sbjct: 170 GGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDGGR 211 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXG-GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G + G GG G G G G GG G GGGG G Sbjct: 178 GDDGGDGGDDGGGSGGGGDDGGSDG--GGGGNDG 209 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -1 Query: 833 GGXXGAXGGGXXGGX--GXRGGGGXXGGGXPGXXPXGXGRWPXXG 705 GG G GGG GG G RGGGG GGG G G GR G Sbjct: 196 GGSKGGYGGGSGGGGYGGGRGGGGY-GGGHGGGGYGGGGRHDYGG 239 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G + GG G GGGG G Sbjct: 181 GGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGG 213 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G G G G GG G GGGG G Sbjct: 203 GGGSGGGGYGGGRGGGGYGGGHGGGGYGG 231 Score = 32.7 bits (71), Expect = 0.43 Identities = 22/56 (39%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRG-GGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GG GG G G GGG GGG G G G + G G + G G Sbjct: 192 GGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGG--HGGGGYGGGGRHDYGGGSKGGG 245 Score = 31.9 bits (69), Expect = 0.74 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GGG G G R GGG GG G G G G G G GG Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGS-KGGYGGGSGGGGYGGGRGGGGYGGGHGG 226 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GGG G GG G GGGG G Sbjct: 192 GGGYGGSKGGYGGGSG--GGGYGGGRGGGGYGG 222 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 G G+ GGG G G GG GG G G GR Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGR 215 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG + GGG G G GGG GG G G G Sbjct: 185 GGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYG 221 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG G GG G G G GGGG Sbjct: 204 GGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG G G G G GG G GGG Sbjct: 203 GGGSGGGGYGGGRGGGGYGGGHGGGGYGGG 232 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G G GG GGG G Sbjct: 212 GGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGG 244 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GGG G Sbjct: 187 GYRSGGG--GYGGSKGGYGGGSGGGGYGGGRGG 217 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P PP PPP P PP PPP P PP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPP--PPPPP 120 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 14/51 (27%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPP--------------RXPXPPXXPPPXAPXXPP 834 P P P PPP PPPP PP PPP AP PP Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G + P P PP P PP PPP P PP Sbjct: 78 GDKKCDVSCMPTSCAPACPPACCAPPPPPPPPPPPPPPPP 117 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 717 PTARXXGXXPRXPPPXXPPPPPXP 788 P A P PPP PPPPP P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPP 119 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GGG GG G RGGGG GGG G Sbjct: 767 GGGGGYRGGGGYGG-GHRGGGGYGGGGHRG 795 Score = 37.1 bits (82), Expect = 0.020 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G GGG GGG G G G G G GG Sbjct: 762 GGGYGGGGGGYRGGGGY-GGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGG 816 Score = 35.1 bits (77), Expect = 0.080 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGX-RGGGGXXGGGXPGXXPXGXGRWPXXG 705 GG GGG GG G GGGG GGG G G G + G Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGG 792 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G G GGGG G Sbjct: 758 GYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGG 790 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG GG G GGG G Sbjct: 757 GGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYG 789 Score = 30.3 bits (65), Expect = 2.3 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 6/62 (9%) Frame = -1 Query: 833 GGXXGAXGGGXX------GGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGX 672 G G GGG GG G R GGG GGG G G G G G Sbjct: 731 GRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGG 790 Query: 671 GG 666 GG Sbjct: 791 GG 792 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 752 GNRSGGGYRG-GGGYG---GGGGGYRGGGGYGG 780 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P TPG G +P P PPP PP P PP PPP Sbjct: 284 PPPPSNTPGMFAS--SGFQPPPPPPTDFAPPP-PPPEPTSELPPPPPPP 329 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 9/49 (18%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRXP---------XPPXXPPPXAPXXPP 834 G P P PPP PPP P PP P AP PP Sbjct: 267 GHPPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPP 315 Score = 29.9 bits (64), Expect = 3.0 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 7/63 (11%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGX-------PPPXXPPPPRXPXPPXXPPPXAPX 825 PP P A+ P P P PG PPP P P PP P P Sbjct: 269 PPIPSASQNATPPPP----PPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPP 324 Query: 826 XPP 834 PP Sbjct: 325 PPP 327 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 36.7 bits (81), Expect = 0.026 Identities = 21/58 (36%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = +1 Query: 652 GGXXXPPXPXATPGXXXG----PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 G PP P + P P G+ P P G P PPP PP PP PPP Sbjct: 337 GQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPP-PPPPGRRPPSGKINPPPPPPP 393 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPP 813 P PPP PPPP P P PPP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPPP 25 Score = 34.7 bits (76), Expect = 0.11 Identities = 26/72 (36%), Positives = 26/72 (36%), Gaps = 7/72 (9%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG----XGRWPXXGPXLXP---GVAXGX 672 G G GG G G G GG GG P P G G P GP L P Sbjct: 76 GGGGGFSGGGGGSMGGGGLGGLFAGGMPKLRPAGERKAAGAGP-RGPALKPPGFRTTAPP 134 Query: 671 GGXXXPPPPXGA 636 PPPP GA Sbjct: 135 PKNSSPPPPFGA 146 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P P PG P + P G P PP PPPP+ PPP Sbjct: 239 PLPAPPPGENRPPPPMRGPTSGGEPP--PPKNAPPPPKRGSSNPPPPP 284 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/77 (29%), Positives = 23/77 (29%), Gaps = 8/77 (10%) Frame = +1 Query: 628 AXXAPXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP----XXPPPPRXPXP 795 A P G PP P P P PPP PPPP Sbjct: 269 APPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQV 328 Query: 796 PXXPPP----XAPXXPP 834 P PPP AP PP Sbjct: 329 PLPPPPLRGQIAPPPPP 345 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +1 Query: 769 PPPPRXPXPPXXPPPXAPXXP 831 PPPP P PP PPP AP P Sbjct: 2 PPPPPPPGPP--PPPSAPSGP 20 Score = 31.5 bits (68), Expect = 0.98 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 5/71 (7%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP-- 810 AP G PP T G P P P PPP PP PP Sbjct: 242 APPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLP 301 Query: 811 ---PXAPXXPP 834 AP PP Sbjct: 302 PSRDQAPAPPP 312 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPP-RXPXPPXXPPPXAPXXPP 834 P P P PPPP R P P PPP P P Sbjct: 343 PPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP 380 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/56 (30%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP A P G ++P G P PP PPPP P + PP Sbjct: 141 PPPFGAPPPPDRGGQLAKKPSQ-GSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPP 195 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP ATP P Q P P G P PP + P PP P P Sbjct: 311 PPPLNATPPPPP-PSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAP 365 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPS 344 P PP P P P GP PPS Sbjct: 4 PPPPPGPPPPPSAPSGPVKPPPS 26 Score = 28.7 bits (61), Expect = 6.9 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 11/67 (16%) Frame = +1 Query: 667 PPXPXATPGXXXGPXX---GQR---PXPXGXX---PGXPPP--XXPPPPRXPXPPXXPPP 813 PP P + G P QR P P G P PP PPP R P PPP Sbjct: 206 PPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPP 265 Query: 814 XAPXXPP 834 PP Sbjct: 266 PKNAPPP 272 Score = 28.7 bits (61), Expect = 6.9 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P PG P G P P PG PP P P PP P P Sbjct: 357 PPPP---PGRAPQPLGGPPPPP----PGRRPPSGKINPPPPPPPAMDKPSFTNGP 404 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 702 RXRXXPTARXXGXXPRXPPPXXPPPPP 782 R P + G P PP PPPPP Sbjct: 451 RGNPRPASSSRGAPPPVPPSRGPPPPP 477 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPP P P Sbjct: 3 PPPPPPGPPPPPSAPSGP 20 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GGG G GG G GGGG G Sbjct: 82 GGGGDGDGGGGGDGDGGGGGDGGGGGDGG 110 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 73 GGGDGGGCDG-GGGDGDGGGGGDGDGGGGGDGG 104 Score = 33.1 bits (72), Expect = 0.32 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPG 744 G G G GG G GGGG GGG G Sbjct: 84 GGDGDGGGGGDGDGGGGGDGGGGGDG 109 Score = 33.1 bits (72), Expect = 0.32 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G G G GG G GGGG GGG Sbjct: 87 GDGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GG GG G GGGG GGG Sbjct: 85 GDGDGGGGGDGDGGGGGDGGGGGDGGG 111 Score = 31.9 bits (69), Expect = 0.74 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXG-XRGGGGXXGGGXPGXXPXGXG 723 G G GGG GG G GGGG G G G G G Sbjct: 70 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG G GGG GG G GGGG G Sbjct: 91 GGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 G G GGG GG GG G GGG G G Sbjct: 67 GNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGG 100 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G GGG G G G G GGG G G G Sbjct: 75 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 111 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGG 400 + GGG G GGG G GG G GGG Sbjct: 88 DGGGGGDGDGGGGG--DGGGGGDGGGG 112 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGG 402 G G GGG GG G D G G GGGG Sbjct: 85 GDGDGGGGGDGDGGGGGD--GGGGGDGGGG 112 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +1 Query: 301 VKXSGXGXG----GGPPXXRGGXGXDPXGXXGXXGGGGAXG 411 V G G G GG GG G D G G GGGG G Sbjct: 69 VGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDG 109 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 G GGG GG G GGGG GGG G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 35.5 bits (78), Expect = 0.060 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG G GGG GG G GGGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GGG GG G GGGG G G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPG 744 GGG GG G GGGG GGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGG 75 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 + GGG G GGG G GG G GGGG G Sbjct: 51 DDGGGGGGGGGGGGG--GGGGGGGGGGGGDG 79 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 809 GGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG GG G GGGG GGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 797 GGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGGG GGG G G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 797 GGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGGG GGG G G G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXG 394 G GGG G GGG G GG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 36.7 bits (81), Expect = 0.026 Identities = 21/58 (36%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = +1 Query: 652 GGXXXPPXPXATPGXXXG----PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 G PP P + P P G+ P P G P PPP PP PP PPP Sbjct: 249 GQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPP-PPPPGRRPPSGKINPPPPPPP 305 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P P PG P + P G P PP PPPP+ PPP Sbjct: 151 PLPAPPPGENRPPPPMRGPTSGGEPP--PPKNAPPPPKRGSSNPPPPP 196 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/77 (29%), Positives = 23/77 (29%), Gaps = 8/77 (10%) Frame = +1 Query: 628 AXXAPXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP----XXPPPPRXPXP 795 A P G PP P P P PPP PPPP Sbjct: 181 APPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQV 240 Query: 796 PXXPPP----XAPXXPP 834 P PPP AP PP Sbjct: 241 PLPPPPLRGQIAPPPPP 257 Score = 31.5 bits (68), Expect = 0.98 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 5/71 (7%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP-- 810 AP G PP T G P P P PPP PP PP Sbjct: 154 APPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLP 213 Query: 811 ---PXAPXXPP 834 AP PP Sbjct: 214 PSRDQAPAPPP 224 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPP-RXPXPPXXPPPXAPXXPP 834 P P P PPPP R P P PPP P P Sbjct: 255 PPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP 292 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/56 (30%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP A P G ++P G P PP PPPP P + PP Sbjct: 53 PPPFGAPPPPDRGGQLAKKPSQ-GSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPP 107 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP ATP P Q P P G P PP + P PP P P Sbjct: 223 PPPLNATPPPPP-PSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAP 277 Score = 28.7 bits (61), Expect = 6.9 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 11/67 (16%) Frame = +1 Query: 667 PPXPXATPGXXXGPXX---GQR---PXPXGXX---PGXPPP--XXPPPPRXPXPPXXPPP 813 PP P + G P QR P P G P PP PPP R P PPP Sbjct: 118 PPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPP 177 Query: 814 XAPXXPP 834 PP Sbjct: 178 PKNAPPP 184 Score = 28.7 bits (61), Expect = 6.9 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P PG P G P P PG PP P P PP P P Sbjct: 269 PPPP---PGRAPQPLGGPPPPP----PGRRPPSGKINPPPPPPPAMDKPSFTNGP 316 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 702 RXRXXPTARXXGXXPRXPPPXXPPPPP 782 R P + G P PP PPPPP Sbjct: 363 RGNPRPASSSRGAPPPVPPSRGPPPPP 389 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP 810 PP P A P P P P G P P PP P PP PP Sbjct: 164 PPAPPAAP--FMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP P P P PP PP AP PP Sbjct: 179 PAPPPPGAPAAP--PAPPFGGPPSAPPPPP 206 Score = 33.9 bits (74), Expect = 0.18 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P A P P P PG P PP P PP PPP P PP Sbjct: 161 PPQPPAPPA---APFMAPAAPPAPPPPGAPAA--PPAPPFGGPPSAPPP--PPAPP 209 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PPS PP Sbjct: 178 PPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXG-PAXXPPSXXGAPP 326 P P PP P P PA PP APP Sbjct: 162 PQPPAPPAAPFMAPAAPPAPPPPGAPAAPP 191 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GGG G GG G GGGG G Sbjct: 97 GGGGDGDGGGGGDGDGGGGGDGGGGGDGG 125 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 88 GGGDGGGCDG-GGGDGDGGGGGDGDGGGGGDGG 119 Score = 33.1 bits (72), Expect = 0.32 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPG 744 G G G GG G GGGG GGG G Sbjct: 99 GGDGDGGGGGDGDGGGGGDGGGGGDG 124 Score = 33.1 bits (72), Expect = 0.32 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G G G GG G GGGG GGG Sbjct: 102 GDGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GG GG G GGGG GGG Sbjct: 100 GDGDGGGGGDGDGGGGGDGGGGGDGGG 126 Score = 31.9 bits (69), Expect = 0.74 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXG-XRGGGGXXGGGXPGXXPXGXG 723 G G GGG GG G GGGG G G G G G Sbjct: 85 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG G GGG GG G GGGG G Sbjct: 106 GGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 G G GGG GG GG G GGG G G Sbjct: 82 GNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGG 115 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G GGG G G G G GGG G G G Sbjct: 90 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 126 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGG 400 + GGG G GGG G GG G GGG Sbjct: 103 DGGGGGDGDGGGGG--DGGGGGDGGGG 127 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGG 402 G G GGG GG G D G G GGGG Sbjct: 100 GDGDGGGGGDGDGGGGGD--GGGGGDGGGG 127 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +1 Query: 301 VKXSGXGXG----GGPPXXRGGXGXDPXGXXGXXGGGGAXG 411 V G G G GG GG G D G G GGGG G Sbjct: 84 VGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDG 124 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 36.7 bits (81), Expect = 0.026 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPPXAP 822 PP PPPP P PP PPP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPP 813 P PPP PPPP P PP P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 35.9 bits (79), Expect = 0.046 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPPP P PP Sbjct: 1308 PESPPPPPPPPPPPPPPP 1325 Score = 35.1 bits (77), Expect = 0.080 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPPP P PP Sbjct: 1311 PPPPPPPPPPPPPPPLPP 1328 Score = 33.1 bits (72), Expect = 0.32 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPP 810 P PP PPPP P PP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 31.9 bits (69), Expect = 0.74 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPPP P P Sbjct: 1313 PPPPPPPPPPPPPLPPTP 1330 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPP 798 P P PPP PPPP P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWP 714 G G GGG GG G GGGG GG G G G P Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPPP 375 Score = 36.3 bits (80), Expect = 0.035 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXP 735 GG G GGG GG G RGGGG G P Sbjct: 343 GGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPPP 375 Score = 33.1 bits (72), Expect = 0.32 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 310 SGXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXR 441 SG G GGG GG G G G GGGG R PP R Sbjct: 339 SGRGGGGG-----GGGGGGGGGGGGGRGGGGGFSSRGRGPPPRR 377 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXGXPKXXP 430 G G G GGG G GG G GGGG + P Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPP 374 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGP 702 GG GG G GGGG GGG G G GP Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGP 373 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG G GGG G GG G G GG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P G P PPP PPP PP P P PP Sbjct: 424 PGGGVPSHPPPLPQPPPSIIPPPTTPLPQTVPTPP 458 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 G+ G PG P PPP P P PPP P Sbjct: 414 GETCTAKGGPPGGGVPSHPPPLPQPPPSIIPPPTTP 449 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 703 GPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 GP G P P PPP PPP P P P P P Sbjct: 422 GPPGGGVPSHPPPLP-QPPPSIIPPPTTPLPQTVPTPPRP 460 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = +1 Query: 703 GPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP----PXXPPPXAPXXPP 834 GP Q P G G PPP P PP+ P P P P P A PP Sbjct: 103 GPPTSQ-PVAYGYPTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPP 149 Score = 29.5 bits (63), Expect = 4.0 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 7/62 (11%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP----PXXPPPXA---PXX 828 P P A P P P G P PP P P P P P PPP A P Sbjct: 130 PYPGAAGPPMPHPTASVYPPPGGYPPTSYPP--QPYPAQPYPQQGYPPQPPPQAYPQPGY 187 Query: 829 PP 834 PP Sbjct: 188 PP 189 Score = 28.7 bits (61), Expect = 6.9 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 6/65 (9%) Frame = +1 Query: 655 GXXXPPXPXAT------PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPX 816 G PP P T PG +P P P P PPP P P P Sbjct: 133 GAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGY 192 Query: 817 APXXP 831 P P Sbjct: 193 PPTGP 197 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 36.3 bits (80), Expect = 0.035 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P PP PP P PP PP P PP Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPP 1052 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P T P P P PPP PP P PP PP P P Sbjct: 1006 PTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 36.3 bits (80), Expect = 0.035 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG G GGG G GG G GGGG Sbjct: 76 GDTDGGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 + GGG GGG G GG G GGGG G Sbjct: 72 DDGGGDTDGGGGCGGGGGGGGGVGGGGGGGG 102 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGG 753 G GGG GG G GGGG GGG Sbjct: 82 GGCGGGGGGGGGVGGGGGGGGGG 104 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GGG G G GGGG GGG G G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGG 103 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGG 756 GG GGG GG G GGGG GG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GGG GG GGGG GGG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 31.9 bits (69), Expect = 0.74 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +2 Query: 287 PPXXX*NXAGXEXGGGPXGXGG-GXGXTXGGXXGXXGGGGXXG 412 PP + + GG G GG G G GG G GGGG G Sbjct: 62 PPNLYVDNDNDDGGGDTDGGGGCGGGGGGGGGVGGGGGGGGGG 104 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG GGG GG G GG G GGG G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGG 103 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GGG G GG GGG G Sbjct: 88 GGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 G GGG GG G GGGG GGG G G Sbjct: 74 GGGDTDGGGGCGGGG--GGGGGVGGGGGGGGGGG 105 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXG 759 GG G GGG GG GGG G Sbjct: 92 GGVGGGGGGGGGGGDDCEDGGGDDG 116 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 36.3 bits (80), Expect = 0.035 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPPXAPXXP 831 PP PPPP P PP PP +P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.1 bits (77), Expect = 0.080 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPPP P PP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PPP PPPP P PP PPP + P Sbjct: 54 PPP--PPPPPPPPPPPPPPPSSSPSRP 78 Score = 33.1 bits (72), Expect = 0.32 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPP 810 P PPP PPPP P PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 29.1 bits (62), Expect = 5.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXP 794 P PPP PPPPP P Sbjct: 59 PPPPPPPPPPPPPSSSP 75 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPPP P Sbjct: 58 PPPPPPPPPPPPPPSSSP 75 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPP 798 P P P PPP PPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.3 bits (80), Expect = 0.035 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 7/63 (11%) Frame = +1 Query: 667 PPXPXATPGXXXG--PXXGQRPXPXGXXPGXPPPXXP----PPPRXPXPPXXPP-PXAPX 825 PP PG P G P P PG PPP P PPP P P PP P Sbjct: 53 PPPNIPIPGNPPPNTPIPGD-PPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPG 111 Query: 826 XPP 834 PP Sbjct: 112 DPP 114 Score = 35.9 bits (79), Expect = 0.046 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 5/58 (8%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP----PPPRXPXPPXXPP-PXAPXXPP 834 P A P P G RP P PG PPP P PPP P P PP P PP Sbjct: 30 PRAPPPNTAIP--GDRP-PNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPP 84 Score = 35.9 bits (79), Expect = 0.046 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 6/58 (10%) Frame = +1 Query: 667 PPXPXATPGXXXG--PXXGQRPXPXGXXPGXPPPXXP----PPPRXPXPPXXPPPXAP 822 PP PG P G P P PG PPP P PPP P P PPP P Sbjct: 63 PPPNTPIPGDPPPNTPIPGD-PPPNTPIPGNPPPNTPIPGDPPPNTPIP-GDPPPNTP 118 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +1 Query: 724 PXPXGXXPGXPPP----XXPPPPRXPXPPXXPP-PXAPXXPP 834 P P PG PPP PPP P PP P PP Sbjct: 13 PPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPP 54 >SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 1042 Score = 35.9 bits (79), Expect = 0.046 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 708 RXXPTARXXGXXPRXPPPXXPPPPPXPXPP 797 R P A PR PPP PPPPP P P Sbjct: 1001 RHFPRAARPPDSPRDPPPITPPPPPVPWFP 1030 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 35.5 bits (78), Expect = 0.060 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPP 813 PPP PPPP+ P PP P P Sbjct: 305 PPPQTPPPPQTPAPPQTPAP 324 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 760 PXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPPP+ P PP P P PP Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAPP 325 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 735 GXXPRXPPPXXPPPPPXPXPP 797 G PPP PPPP P PP Sbjct: 299 GTPQTPPPPQTPPPPQTPAPP 319 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 748 GXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 G P PPP P P PP P P Sbjct: 298 GGTPQTPPPPQTPPPPQTPAPPQTPAPP 325 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 35.5 bits (78), Expect = 0.060 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXP 831 PPP PPP P PP PPP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 33.5 bits (73), Expect = 0.24 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPPPP P PP Sbjct: 79 PPPPPPPPPPPPPPP 93 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAP 822 PPP PPPP P PP P P Sbjct: 79 PPPPPPPPPPPPPPPGAKKPDDP 101 Score = 31.9 bits (69), Expect = 0.74 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PP PPPPP P PP Sbjct: 75 PLCAPPPPPPPPPPPPPP 92 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 772 PPPRXPXPPXXPPPXAPXXPP 834 PPP PP PPP P PP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPPP P PP Sbjct: 73 PPPLCAPPPPPPPPP 87 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 744 PRXPPPXXPPPPPXP 788 P PPP PPPPP P Sbjct: 79 PPPPPPPPPPPPPPP 93 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PP PPPPP P PP Sbjct: 74 PPLCAPPPPPPPPPP 88 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPPP P Sbjct: 81 PPPPPPPPPPPPPGAKKP 98 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 35.5 bits (78), Expect = 0.060 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPPP P PP Sbjct: 65 PTLPPPPPPPPPPLPPPP 82 Score = 35.1 bits (77), Expect = 0.080 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 760 PXXPPPPRXPXPPXXPPPXAPXXPP 834 P P PP P PP PPP P PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPP 813 PP PPPP P PP PPP Sbjct: 64 PPTLPPPPPPPPPPLPPPP 82 Score = 31.5 bits (68), Expect = 0.98 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPP 798 P PPP PPPP P PP Sbjct: 65 PTLPPPPPPPPPPLPPPP 82 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = +3 Query: 744 PRXP-PPXXPPPPPXPXPP 797 P P PP PPPPP P PP Sbjct: 59 PTVPIPPTLPPPPPPPPPP 77 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 754 PPPXXPPPPRXPXPP 798 PPP PPPP P PP Sbjct: 69 PPPPPPPPPLPPPPP 83 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPPP P PP Sbjct: 69 PPPPPPPPPLPPPPP 83 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 35.5 bits (78), Expect = 0.060 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXP 831 PPP PPP P PP PPP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 33.5 bits (73), Expect = 0.24 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPPPP P PP Sbjct: 280 PPPPPPPPPPPPPPP 294 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAP 822 PPP PPPP P PP P P Sbjct: 280 PPPPPPPPPPPPPPPGAKKPDDP 302 Score = 31.9 bits (69), Expect = 0.74 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PP PPPPP P PP Sbjct: 276 PLCAPPPPPPPPPPPPPP 293 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 772 PPPRXPXPPXXPPPXAPXXPP 834 PPP PP PPP P PP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPPP P PP Sbjct: 274 PPPLCAPPPPPPPPP 288 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 744 PRXPPPXXPPPPPXP 788 P PPP PPPPP P Sbjct: 280 PPPPPPPPPPPPPPP 294 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PP PPPPP P PP Sbjct: 275 PPLCAPPPPPPPPPP 289 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPPP P Sbjct: 282 PPPPPPPPPPPPPGAKKP 299 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 35.5 bits (78), Expect = 0.060 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPPP P PP Sbjct: 289 PTLPPPPPPPPPPLPPPP 306 Score = 35.1 bits (77), Expect = 0.080 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 760 PXXPPPPRXPXPPXXPPPXAPXXPP 834 P P PP P PP PPP P PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPP 813 PP PPPP P PP PPP Sbjct: 288 PPTLPPPPPPPPPPLPPPP 306 Score = 31.5 bits (68), Expect = 0.98 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPP 798 P PPP PPPP P PP Sbjct: 289 PTLPPPPPPPPPPLPPPP 306 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = +3 Query: 744 PRXP-PPXXPPPPPXPXPP 797 P P PP PPPPP P PP Sbjct: 283 PTVPIPPTLPPPPPPPPPP 301 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 754 PPPXXPPPPRXPXPP 798 PPP PPPP P PP Sbjct: 293 PPPPPPPPPLPPPPP 307 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPPP P PP Sbjct: 293 PPPPPPPPPLPPPPP 307 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 35.5 bits (78), Expect = 0.060 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 688 PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PG P RP P P P PP P P PP P PP Sbjct: 209 PGNGVVPTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPP 257 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P PPP P PP P P PPP P P Sbjct: 216 PEPDYLEPTPPPPAAPAPP--PPPAAAPPPPPPPPP 249 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 P ATP P + P P PPP PP P PP P A Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKPAA 255 Score = 31.9 bits (69), Expect = 0.74 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P PP PP P PP Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPP 249 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 35.5 bits (78), Expect = 0.060 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 8/64 (12%) Frame = +1 Query: 655 GXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP----PRXPXP----PXXPP 810 G P P P G P P PG P P PPP PR P P P PP Sbjct: 545 GAPHPRVPPPGASHPRVPPPGA-PHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPP 603 Query: 811 PXAP 822 P AP Sbjct: 604 PGAP 607 Score = 35.1 bits (77), Expect = 0.080 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 8/69 (11%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP----PRXPXP---- 795 P G P P A+ P P P PG P P PPP PR P P Sbjct: 402 PPPGAPHPRVPPPGASHQRVRPPGA---PHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPH 458 Query: 796 PXXPPPXAP 822 P PPP AP Sbjct: 459 PRVPPPGAP 467 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 8/41 (19%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPP----PRXPXP----PXXPPPXAP 822 P P PG P P PPP PR P P P PPP AP Sbjct: 437 PHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 477 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 8/41 (19%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPP----PRXPXP----PXXPPPXAP 822 P P PG P P PPP PR P P P PPP AP Sbjct: 447 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 487 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 8/41 (19%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPP----PRXPXP----PXXPPPXAP 822 P P PG P P PPP PR P P P PPP AP Sbjct: 457 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 497 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 8/41 (19%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPP----PRXPXP----PXXPPPXAP 822 P P PG P P PPP PR P P P PPP AP Sbjct: 507 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 547 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 8/41 (19%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPP----PRXPXP----PXXPPPXAP 822 P P PG P P PPP PR P P P PPP AP Sbjct: 537 PHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAP 577 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP----PXXP 807 P G PP P QR P G PP P PR P P P P Sbjct: 473 PPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 532 Query: 808 PPXAP 822 PP AP Sbjct: 533 PPGAP 537 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 10/47 (21%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPP----PRXPXP----PXXPPPXA--PXXPP 834 P P PG P P PPP PR P P P PPP A P PP Sbjct: 517 PHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPP 563 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 5/66 (7%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXG-QRPXPXGXXPGXPPPXXPPPPRXPXP----PXX 804 P G P P A P QR P G PP P PR P P P Sbjct: 392 PSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRV 451 Query: 805 PPPXAP 822 PPP AP Sbjct: 452 PPPGAP 457 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 5/66 (7%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXX-GPXXGQRPXPXGXXPGXPPPXXP----PPPRXPXPPXX 804 P G PP P G + P P P PPP P PPP P P Sbjct: 453 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPH-PRV 511 Query: 805 PPPXAP 822 PPP AP Sbjct: 512 PPPGAP 517 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 5/66 (7%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXX-GPXXGQRPXPXGXXPGXPPPXXP----PPPRXPXPPXX 804 P G PP P G + P P P PPP P PPP P P Sbjct: 533 PPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPH-PRV 591 Query: 805 PPPXAP 822 PPP AP Sbjct: 592 PPPGAP 597 Score = 33.1 bits (72), Expect = 0.32 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 5/66 (7%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXX-GPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP----PXX 804 P G PP P G + P P P PPP P PR P P P Sbjct: 503 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP-HPRVPPPGASHPRV 561 Query: 805 PPPXAP 822 PPP AP Sbjct: 562 PPPGAP 567 Score = 32.3 bits (70), Expect = 0.56 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 5/66 (7%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXX-GPXXGQRPXPXGXXPGXPPPXXP----PPPRXPXPPXX 804 P G PP P G + P P P PPP P PPP P P Sbjct: 523 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPH-PRV 581 Query: 805 PPPXAP 822 PPP P Sbjct: 582 PPPGTP 587 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPP---XAPXXPP 834 PG PPP P PR P PPP P PP Sbjct: 297 PGYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPP 329 Score = 31.9 bits (69), Expect = 0.74 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 4/65 (6%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP----PXXP 807 P G PP P R P G PP P PR P P P P Sbjct: 463 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVP 522 Query: 808 PPXAP 822 PP AP Sbjct: 523 PPGAP 527 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGX-PPPXXPPPPRXPXPPXXPP 810 P P P P PPP PPPR P PP P Sbjct: 300 PPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAP 335 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P PP R P P PPP P P Sbjct: 306 PHPRMRPPTRIPPPGMGPPPRIPPPP 331 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P RP PG PP PPP P PP AP Sbjct: 306 PHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAP 344 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 G P P PP PPP PP PPP Sbjct: 298 GYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPP 330 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP----PPPRXPXPPXXPPPXA 819 PP T G + P P P P P PPP P P PPP A Sbjct: 363 PPDGPYTRALPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPH-PRVPPPGA 416 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 35.1 bits (77), Expect = 0.080 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 G G GGG GG G G G GGG G G GR Sbjct: 163 GGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGR 199 Score = 35.1 bits (77), Expect = 0.080 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRG-GGGXXGGGXPG 744 GG G GGG GG RG GGG GGG G Sbjct: 166 GGNGGGRGGGEGGGGRGRGTGGGSRGGGGDG 196 Score = 33.1 bits (72), Expect = 0.32 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G G G GG G RGGG GGG G G G G G GG Sbjct: 134 GRGGGEGNGAGGGIG-RGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGG 187 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRG-GGGXXGGGXPGXXPXGXG 723 GG G GG G G RG GGG G G G G G Sbjct: 136 GGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRG 173 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG G GG G GG G GGGG Sbjct: 152 GRGRGGGEGGW-GGRGGNGGGRGGGEGGGG 180 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GGG G GG G G G GGGG Sbjct: 169 GGGRGGGEGGGGRGRGTGGGSRGGGG 194 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 35.1 bits (77), Expect = 0.080 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P ATP P P P P P P P PP P P P P PP Sbjct: 251 PLPPATPNPFIPPAS---PNP-SIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPP 301 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 730 PXGXXPGXPPPXX-PPPPRXPXPPXXPPPXAPXXPP 834 P P P P P PP P PP P P AP PP Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPP 207 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P P P P PP P P P P P PP Sbjct: 179 PPAPSTIPTPPTPPAPPSPPIPTAP-PTPPMPETPLPPGSPHIP--PAPLHPHIPP 231 Score = 33.5 bits (73), Expect = 0.24 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXAT--PGXXXGPXXGQRPXPXGXXPGXPP-PXXPP-PPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PP P PP PP PP P P P PP Sbjct: 297 PPAPPNLFIPSAPPNPHIPPAP-PNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 33.1 bits (72), Expect = 0.32 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPX---ATPGXXXG--PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P ATP P P P P P P PP P P P P P P P Sbjct: 233 PPNPSKAIATPNPPMPETPLPPATPNPF-IPPASPNPSIPPAPPNPSIPAPPNPSIPLAP 291 Query: 832 P 834 P Sbjct: 292 P 292 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 721 RPXPXGXXPGXPPPXXPPPPRXPXPPXXPP-PXAPXXP 831 +P P P P PP P P P PP P P P Sbjct: 178 KPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPP 215 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P PP P PP P P P P P P Sbjct: 177 PKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETP 212 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP-PPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P P PP PP PP P P P Sbjct: 309 PPNPHIPPAPP-NPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPP--PXXPPPPRXPXPPXXPP 810 PP P A P P P P PP P PP P P P PP Sbjct: 188 PPTPPAPPSP---PIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPP 234 Score = 28.3 bits (60), Expect = 9.2 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXX-PGXPP-PXXPP-PPRXPXPPXXPPPXAPXXPP 834 P P P P P P PP P PP PP P P P P PP Sbjct: 262 PPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPP 319 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 35.1 bits (77), Expect = 0.080 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG GG G GGGG GGG G G G G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGG--GGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDG 355 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP 654 G G GG GG G GGGG GGG G G G G G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDG-DDGWGVRALC 362 Query: 653 PPPXG 639 P P G Sbjct: 363 PIPQG 367 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G G G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDG 338 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G GGG G GG G GGGG G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGG 329 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G G G Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDG 342 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 35.1 bits (77), Expect = 0.080 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 AG GGG G GG G G G GGGG G Sbjct: 73 AGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGG 106 Score = 32.7 bits (71), Expect = 0.43 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 301 VKXSGXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXG 411 V G G GGG GG G G G G GGA G Sbjct: 53 VGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAG 89 Score = 32.7 bits (71), Expect = 0.43 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GGG GG G G G GGG G G + G + G GG Sbjct: 61 GGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGG 109 Score = 32.3 bits (70), Expect = 0.56 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP 654 GG GGG GG G GGG G G G G G G G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGA 87 Query: 653 PPPXGA 636 GA Sbjct: 88 AGAAGA 93 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG GA GG G G GG GGG G G Sbjct: 77 GGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNG 111 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG GA G G G G G GG G G G Sbjct: 85 GGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GA G G GG GGG G G G G G V G G Sbjct: 50 GNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSG 105 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 AG G G G GGG GG GGGG Sbjct: 49 AGNGVGAGGCGCGGGNDGGNGGGGAGNGGGG 79 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGG 400 G GGG GGG G GG G G G Sbjct: 66 GGNGGGGAGNGGGGGGAGNGGAAGAAGAG 94 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXG---GGGXXG 412 G GGG G GGG G G G G GGG G Sbjct: 31 GVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDG 66 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GG G G G GG G GGGG Sbjct: 43 GGNGGGAGNGVGAGGCGCGGGNDGGNGGGG 72 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 35.1 bits (77), Expect = 0.080 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +1 Query: 745 PGXPPPXXP-PPPRXPXPPXXPPPXAPXXPP 834 P P P P PPP P P PPP P PP Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPPPP 928 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 7/45 (15%) Frame = +1 Query: 721 RPXPXGXXPGXPPPXX----PPPPRXPXPPXXPP---PXAPXXPP 834 RP P PPP PPPP P PP PP AP PP Sbjct: 948 RPTPPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP 780 PP TP P P P P PPP PPPP Sbjct: 894 PPTTPTTPK----PTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP 810 P P P P P P P PP P PP PP Sbjct: 895 PTTPTTPKPTTPAPPPPLPLAPEPP-PPLPPPPPP 928 Score = 28.3 bits (60), Expect = 9.2 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 744 PRXPPPXXPPPPP 782 P PPP PPPPP Sbjct: 916 PEPPPPLPPPPPP 928 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRG-GGGXXGGGXPGXXPXGXG 723 GG G+ GG GG G G GGG GGG G G G Sbjct: 101 GGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYG 138 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 G G GGG GG G G GG GGG G Sbjct: 110 GYGGGRGGGGYGGGRGGGGYGGGRGGGYGG 139 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 311 AGXEXGGGPXGXGGG-XGXTXGGXXGXXGGGGXXG 412 AG GG GGG G + GG G GGGG G Sbjct: 88 AGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGG 122 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG G GGG GG RGGGG GGG G G Sbjct: 109 GGYGGGRGGGGYGGG--RGGGGY-GGGRGGGYGGG 140 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G G G R GGG GG G G G G G G GG Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGG 135 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGG 400 G GGG G G G G GG G GGG Sbjct: 112 GGGRGGGGYGGGRGGGGYGGGRGGGYGGG 140 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGG 756 GG G GGG GG GGG GG Sbjct: 127 GGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G G G G GG G GGG G Sbjct: 112 GGGRGGGGYGGGRGGGGYGGGRGGGYGGG 140 Score = 28.7 bits (61), Expect = 6.9 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXG-GGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G+ GG G G GG G GG G G GR G G G GG Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGR---GGGGYGGGRGGGYGG 139 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G G GGG G GG GGG G Sbjct: 119 GYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGG 151 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPP-PRXPXPPXXPPPXAPXXPP 834 + P P PPP P P+ P PP PP P PP Sbjct: 552 EEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 32.7 bits (71), Expect = 0.43 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP-PPPRXPXPPXXPPPXAP 822 P P P P P PP P PPP P PP PP P Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PP PPPP PP PP P PP Sbjct: 550 PSEEPP--PPPPGVDIPPPLPPSEDPKPPP 577 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P PP PPP P PPP P P Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPP 583 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-PRXPXPPXXPPPXAPXXPP 834 P P T P R P P PP PPP P P PPP P PP Sbjct: 160 PIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 216 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-PRXPXPPXXPPPXAPXXPP 834 P P P P R P P PP PPP P P PPP P PP Sbjct: 150 PAPMTLP--PISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 203 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP--PPRXPXPPXXPPPXAP 822 PP P P P P P P PP PP PPR PP P P P Sbjct: 182 PPIPPIDPPRTQPP-----PIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTP 230 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-PRXPXPPXXPPPXAP 822 P P T P R P P PP PPP P P PPP P Sbjct: 173 PIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFP 225 Score = 29.5 bits (63), Expect = 4.0 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPX-PXGXXPGXPPPXXPP--PPRXPXPPXXPPPXAPXXPP 834 PP P P Q P P P PP PP PPR PP PP P P Sbjct: 163 PPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQ-PPPIPPIDPPRTQP 220 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 G P P G PPP PP P PP PPP Sbjct: 651 GIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 724 PXPX-GXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P G P PP PP P PP P P PP Sbjct: 645 PNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 682 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P G P PP P PP P PP PP A P Sbjct: 515 PSCCGSYPAPQPPSPPAPPPKPAPPPRSPPAAAPCNP 551 Score = 31.9 bits (69), Expect = 0.74 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP--PPXAP 822 G P P P PPP PPPR P P P P AP Sbjct: 519 GSYPAPQPPSPPAPPPKPAPPPRSP-PAAAPCNPAMAP 555 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXP 831 PPP PPPP PP PPP P P Sbjct: 96 PPPATPPPP--TMPPTPPPPQTPAPP 119 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P P P PPPP+ P PP P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 748 GXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G PPP PPP P P PPP PP Sbjct: 93 GDPPPPATPPP--PTMPPTPPPPQTPAPP 119 Score = 31.9 bits (69), Expect = 0.74 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXP 831 PPP PP P P P P P P P Sbjct: 102 PPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 685 TPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 T G P P P P PPP P PP P P P P Sbjct: 88 TCGTCGDPPPPATPPPPTMPPTPPPPQTPAPP-GPDTPAPPAP 129 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P PPP PP P PP P P P P Sbjct: 98 PATPPPPTMPP--TPPPPQTPAPPGPDTP 124 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 G GG GG G GGG GGG G G GR Sbjct: 106 GGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGR 139 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG G GGG G G RGGGG GGG Sbjct: 114 GGYGGGRGGGGYG--GGRGGGGSYGGG 138 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G GGG G G R GGG GG G G G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRG 121 Score = 32.3 bits (70), Expect = 0.56 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGXGGG-XGXTXGGXXGXXGGGGXXG 412 G GGG GGG G + GG G GGGG G Sbjct: 94 GGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGG 127 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 809 GGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG GG GGGG GGG G G GR Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGR 341 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/31 (51%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRG-GGGXXGGGXPG 744 GG G+ GG GG G G GGG GGG G Sbjct: 106 GGYGGSSRGGYGGGRGGGGYGGGRGGGGSYG 136 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXG-GGXPGXXPXGXGR 720 G G+ GGG G G GG G GG G G GR Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGR 129 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 G GGG G G GGG GG G G GR Sbjct: 313 GGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGR 346 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRW 717 GGG GG G GG GGG G G G + Sbjct: 104 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSY 135 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG GGG GG RGGG GGG G Sbjct: 317 GGYRSGGGGGYGGG---RGGGRGYGGGRGG 343 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGG--XXGGG 753 GG G GGG G G RGGGG GGG Sbjct: 325 GGYGGGRGGG-RGYGGGRGGGGRRDYGGG 352 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/66 (31%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXP-GXPPPXXPPPPRXPXPPXXPPPX 816 P G PP P PG P GQ P P G PP P + PP P Sbjct: 60 PPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQPYGAPPTSGYPGYQQHPPPPQPSAQ 119 Query: 817 APXXPP 834 + PP Sbjct: 120 SYNAPP 125 Score = 32.7 bits (71), Expect = 0.43 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXP----GXPPPXXPPPPRXPXPPXXPPP 813 P A PG G P P G P G PP PPP+ PPP Sbjct: 23 PPAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPP 72 Score = 29.1 bits (62), Expect = 5.2 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 6/71 (8%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATP--GXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP----X 801 P GG PP P P G P G P P G PPP P PP Sbjct: 31 PPAPGGY--PPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYG 88 Query: 802 XPPPXAPXXPP 834 PP P P Sbjct: 89 APPTSQPYGAP 99 Score = 28.7 bits (61), Expect = 6.9 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 4/69 (5%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXG--PXXGQRPXPXGXXPGXPP--PXXPPPPRXPXPPXXP 807 P GG PP P P G P G P G P P PPPP P Sbjct: 24 PAAPGGY--PPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGP 81 Query: 808 PPXAPXXPP 834 PP P Sbjct: 82 PPSGQYGAP 90 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 G GG GG G GGG GGG G G GR Sbjct: 197 GGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGR 230 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG G GGG G G RGGGG GGG Sbjct: 205 GGYGGGRGGGGYG--GGRGGGGGYGGG 229 Score = 32.3 bits (70), Expect = 0.56 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGXGGG-XGXTXGGXXGXXGGGGXXG 412 G GGG GGG G + GG G GGGG G Sbjct: 185 GGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGG 218 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GGG G G R GGG GG G G G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRG 212 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXG-GGXPGXXPXGXGR 720 G G+ GGG G G GG G GG G G GR Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGR 220 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 G G GGG GG G GG GGG G Sbjct: 210 GRGGGGYGGGRGGGGGYGGGRRDYGGGSKG 239 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG + GGG G GGG GGG G G G Sbjct: 189 GGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGG 225 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G GGG G GG G GGGG G Sbjct: 197 GGYGGSSRGGYGGGRG--GGGYGGGRGGGGGYG 227 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G G GG GGG G Sbjct: 208 GGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRG--GGGXXGGGXPG 744 GG G+ GG GG G G GG GGG G Sbjct: 197 GGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGG 228 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP---PRXPXPPXXPPPXAPXXPP 834 P P TP P G P P PPP PP P PP PP PP Sbjct: 20 PKPPQPTPPKPDTPPPGTN-IPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +1 Query: 667 PPXPXATPGXXX--GPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P P P P P P PP PP P P PPP P Sbjct: 27 PPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQP-PVTQPPPPVTQSP 82 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = +1 Query: 670 PXPXATPGXXXG-PXXGQRPXPXGXXPGXPPPXXPPP---PRXPXPPXXPPP 813 P ATP P P P P P P PPP P PP PP Sbjct: 14 PVDQATPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPP 65 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG G GGG GG G GGG GGG Sbjct: 103 GGGGGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG GG GG G GGGG GGG G G Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG GGGG G Sbjct: 100 GGRGGGGGYGGGGGYG---GGGRSYGGGGGGGG 129 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GGG G GGGG GGG G G G G GG Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP 807 P G G PP P PG GP G P G P PP P P PP P Sbjct: 396 PRGMGPGMGPPRPMGPPG-PHGPPFG----PRGPPPHGGPPRGPMGPGPGMPPMRP 446 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXX-GPXXGQRPXPXGXXPGXPPPXXPP-PPRXPXPPXXPPPXAPXXPP 834 PP PG GP G P P G PP P PP PP P P PP Sbjct: 387 PPKEDWGPGPRGMGPGMGP-PRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPP 443 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = -2 Query: 448 GRTGXXGXXFWGPXXPPPPXXPXXXPXGPA-XXPPSXXG 335 G G G F GP PPP P P GP PP G Sbjct: 410 GPPGPHGPPF-GPRGPPPHGGPPRGPMGPGPGMPPMRPG 447 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 33.9 bits (74), Expect = 0.18 Identities = 26/74 (35%), Positives = 29/74 (39%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRXXX 492 G G GGG +GG G P G G GGG R P P R++ Sbjct: 301 GRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMG----RGPGGGLGRGPGGGWGRMQ----- 351 Query: 493 XGGGXGXGXGXGXG 534 GGG G G G G G Sbjct: 352 -GGGMGRGPGQGWG 364 Score = 31.5 bits (68), Expect = 0.98 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGG---XXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G G G GG G GGG GGG G GR G PG G G Sbjct: 309 GRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQGWGCRG 367 Score = 31.1 bits (67), Expect = 1.3 Identities = 26/79 (32%), Positives = 26/79 (32%), Gaps = 5/79 (6%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGG---GAXGXPKRXPPEXRXAPPXPFTPRLRSR 483 G G G G P GG G P G GGG G G R P R Sbjct: 231 GIGRGSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGG 290 Query: 484 --XXXXGGGXGXGXGXGXG 534 GGG G G G G G Sbjct: 291 GWGRMQGGGMGRGPGGGWG 309 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXG 675 GG G GG G RG G GGG G GR G PG G Sbjct: 257 GGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWG 309 Score = 29.9 bits (64), Expect = 3.0 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GGG G G RG G GGG G GR G PG G G Sbjct: 242 GGGM--GQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRG 287 Score = 29.9 bits (64), Expect = 3.0 Identities = 24/65 (36%), Positives = 25/65 (38%), Gaps = 4/65 (6%) Frame = -1 Query: 821 GAXGGGXXGGXGX-RGG-GGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXG--XGGXXXP 654 G G G GG G +GG G GGG G GR P G PG G GG Sbjct: 298 GGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGR 357 Query: 653 PPPXG 639 P G Sbjct: 358 GPGQG 362 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GG G GGG G GG G GGG Sbjct: 282 GGWGRGSGGGWGRMQGGGMGRGPGGG 307 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 782 RGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 RG G GG G P G GR G PG G G Sbjct: 234 RGSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWGRG 271 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +1 Query: 655 GXXXPPXPXATPGXXX-GPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP 810 G PP P P P RP P PPP P P P P PP Sbjct: 775 GAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 736 GXXPGXPPPXXPPPPRXPXP-PXXPPPXAPXXPP 834 G P PPP P PR P P PP P PP Sbjct: 775 GAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPP 808 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 724 PXPXGXXPGXP--PPXXP--PPPRXPXPPXXPPPXAPXXP 831 P P P P PP P PP P PP PPP P P Sbjct: 779 PPPPPTKPATPRVPPNIPSRPPGARPTPPP-PPPGKPTKP 817 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +1 Query: 748 GXPPPXXPPPPRXPXPPXXPPP---XAPXXPP 834 G PP PPPP PP PPP P PP Sbjct: 234 GHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPP 265 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP--PXXPPPXAPXXPP 834 PP P + P P G P P G P PPP P P P PP PP Sbjct: 241 PPPPHSMPPPGM-PPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPP 297 Score = 32.3 bits (70), Expect = 0.56 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +1 Query: 655 GXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G P A P P G P PG PP P P PP PPP P P Sbjct: 231 GMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMP-PPGMPPPMPPGGMP 289 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG G GGG G GG G GGGG G Sbjct: 406 GGYRGRGGGRGYYRGGRGGGRGGGGRGG 433 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 33.9 bits (74), Expect = 0.18 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP-PXXPPPX 816 P G G PP P PG G P G PG P PP P+ P P P P Sbjct: 1790 PQGPKGMPGPPGPPGPPGAIG--WKGNPGNPAGP-PGLDGPPGPPGPQGPKGWPGVPGPP 1846 Query: 817 AP 822 P Sbjct: 1847 GP 1848 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-PRXPXPPXXP 807 P G G PP P G P P PG P P P P P PP P Sbjct: 1793 PKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPP 1849 Score = 32.7 bits (71), Expect = 0.43 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP-PPRXPXPPXXPP-PXAPXXPP 834 P P P GP P G P PP PP P P P P AP PP Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPP 1716 Score = 31.5 bits (68), Expect = 0.98 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +2 Query: 245 RGLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXGXP 418 +G K GPP PP PP GP G G G G G G G G P Sbjct: 1791 QGPKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPP--GPQGPKGWPGVPGPP 1846 Score = 29.5 bits (63), Expect = 4.0 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +2 Query: 269 PPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXT-XGGXXGXXGGGGXXGXPKXXP 430 PP PPPP G GP G G G G G G G G P P Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPP 1716 Score = 29.5 bits (63), Expect = 4.0 Identities = 41/172 (23%), Positives = 42/172 (24%), Gaps = 4/172 (2%) Frame = +1 Query: 331 GPPXXRGGXGXD-PXGXXGXXGGGGAXGXP-KRXPPEXRXAPPXPFTPRLRSRXXXXGGG 504 GPP G G P G G G G G P + P AP P P G Sbjct: 1671 GPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGP--PGRDGPMGPPGPS 1728 Query: 505 XGXGXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXX-APXGGGGXXXPPXPX 681 G G G A G G PP Sbjct: 1729 GGQGPPGDMGSMGPMGMGGEHKDFKRSASAQVGQYGYPSQAASYIGTQGASGVDGPPGLA 1788 Query: 682 ATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP-PPRXPXPPXXPPPXAPXXPP 834 G P P P G P P PP PP P P P P Sbjct: 1789 GPQGPKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWP 1840 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 527 PWPXPXPXPPPXXXXRDLSRGVXGXGGAXRXSGGXLLGXPXAPPPPXXPXXP 372 P P P P P P D G+ G G G G P P P P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPP--GPPGLPGPQGIPGYP 1709 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG GGG GG G GGG GG G G G + G+ G G Sbjct: 168 GGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMG 222 Score = 32.3 bits (70), Expect = 0.56 Identities = 21/57 (36%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXG-GGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG G GGG GGG G G G + G+ G GG Sbjct: 142 GGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSM--AGGGMGGGMGGGMGGGMEGGMGG 196 >SB_57323| Best HMM Match : ShTK (HMM E-Value=0) Length = 911 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP---PPRXPXPPXXPP 810 G G PP +PG P P P PP PP PP P PP PP Sbjct: 670 GSGTTVAPPQTTVSPGTPVPPTDD--PDCTTETPDTQPPTQPPVTQPPDTPVPPTQPP 725 >SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) Length = 892 Score = 33.9 bits (74), Expect = 0.18 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 3/68 (4%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXG-QRPXPXGXXPGXPPPXXPPPPRXPXPPXXP--P 810 P GG P P A PG G P G P PPP PP P P P P Sbjct: 799 PTQGGPPQAQPPPHAPPGQAHYQQLGAAAPNQGGYHPQQPPP--PPQGYEPQPQYQPQGP 856 Query: 811 PXAPXXPP 834 P PP Sbjct: 857 PQYYGGPP 864 Score = 29.1 bits (62), Expect = 5.2 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = -2 Query: 535 PPXXGXAPXPXPPPXTXXGT*AGG*XGXGGRTGXXGXXFWGPXXPPPPXXPXXXPXGPAX 356 PP G P PPP G G + PPPP P Sbjct: 798 PPTQGGPPQAQPPPHAPPGQ---AHYQQLGAAAPNQGGYHPQQPPPPPQGYEPQPQYQPQ 854 Query: 355 XPPSXXGAPP 326 PP G PP Sbjct: 855 GPPQYYGGPP 864 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PPP PPPP P PPP P PP Sbjct: 82 PPPPPPPPPASNVPAPPPPP--PVMPP 106 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P PPP PP P PP PP P Sbjct: 77 PAAVIP-PPPPPPPPASNVPAPPPPPPVMPP 106 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P P PP PPPP P PP P P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGP 254 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +1 Query: 724 PXPXGXXPGXPPP-XXPPPPRXPXPP 798 P P P PPP PPPP P PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P PP P P PPP P P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGPP 255 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAP 822 P PPP PPPP P PPP P Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPP 806 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 3/21 (14%) Frame = +3 Query: 744 PRXPPPXXPPPPP---XPXPP 797 P PPP PPPPP P PP Sbjct: 781 PTTPPPEYPPPPPGLARPNPP 801 >SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) Length = 245 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 430 GXXFWGPXXPPPPXXPXXXPXGPAXXPPSXXGAP 329 G F P PPPP P P P+ PP G P Sbjct: 180 GYPFQYPGTPPPPMYPAFPPIFPSSPPPEYPGLP 213 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 430 GXXFWGPXXPPPPXXPXXXPXGPAXXPPSXXGAP 329 G F P PPPP P P P+ PP G P Sbjct: 90 GYPFQYPGTPPPPMYPAFPPSFPSSPPPEYPGLP 123 >SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 430 GXXFWGPXXPPPPXXPXXXPXGPAXXPPSXXGAP 329 G F P PPPP P P P+ PP G P Sbjct: 143 GYPFQYPGTPPPPMYPAFPPSFPSSPPPEYPGLP 176 >SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 430 GXXFWGPXXPPPPXXPXXXPXGPAXXPPSXXGAP 329 G F P PPPP P P P+ PP G P Sbjct: 180 GYPFQYPGTPPPPMYPAFPPIFPSSPPPEYPGLP 213 >SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) Length = 245 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 430 GXXFWGPXXPPPPXXPXXXPXGPAXXPPSXXGAP 329 G F P PPPP P P P+ PP G P Sbjct: 180 GYPFQYPGTPPPPMYPAFPPSFPSSPPPEYPGLP 213 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 730 PXGXXPGX-PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P G P PPP PP R PP PPP PP Sbjct: 275 PPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPP 310 Score = 32.3 bits (70), Expect = 0.56 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P A PG P G P G PPP PPP PP P PP Sbjct: 270 PFNQAPPGFP--PRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPP 322 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXP---GXPPPXXPPPPR 783 P G PP P P RP P P G PPP PPP+ Sbjct: 280 PRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPPPQ 330 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 33.1 bits (72), Expect = 0.32 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 4/67 (5%) Frame = +1 Query: 646 GGGGXXXPPXPXATP----GXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 G G P P ATP Q+P P P P PP R PP P P Sbjct: 387 GPNGVIYEPIPNATPIMAKDAVKYEPPQQQPQQQRQSPPQPSPTGAPPQRPHPPPQQPSP 446 Query: 814 XAPXXPP 834 P P Sbjct: 447 RPPMGVP 453 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P P PPR P P PP P P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTPRPGPP 1383 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P P P P PP PR P P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPP-PXAP 822 P PPP P PP+ P P PP P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETP 1601 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXG 705 G G GGG GG G GGG G G G +W G Sbjct: 34 GYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKWNNGG 76 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPG 744 G GGG G G GGGG GGG G Sbjct: 27 GGHGGGHGYGGGPNGGGGGGGGGGGG 52 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G G G G G G GGGG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 + GGG G G G GG G GGGG G Sbjct: 24 DGGGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 G G GG GG GGGG GGG G G+ Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGK 61 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G G GG GGGG GGG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGGP G GGG G GG G G G Sbjct: 32 GHGYGGGPNGGGGGGGG-GGGGGGDEDDSGKNG 63 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 796 GGXGXGGGGGXXGGGXRG 743 GG G GGGGG GGG RG Sbjct: 514 GGGGGGGGGGGGGGGGRG 531 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXP 747 G GGG GG G GG G G G P Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRGRP 538 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPG 744 GGG GG G GGGG GG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGG 768 G G GGG GG G RGG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRG 534 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP PPPP PPP PP Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGPPP 540 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 796 GGXGXGGGGGXXGGGXRG 743 GG G GGGGG GGG RG Sbjct: 1003 GGGGGGGGGGGGGGGRRG 1020 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGG 756 G G GGG GG G RGG G G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGGARG 1027 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXG 394 GGG G GGG G GG G G Sbjct: 1005 GGGGGGGGGGGGGRRGGRGGARG 1027 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 667 PPXPXATPGXXXG-PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP---XXPPPXAP 822 PP P P G P Q P PG P PPP PP PPP P Sbjct: 156 PPPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPPPYVP 211 Score = 32.3 bits (70), Expect = 0.56 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 4/65 (6%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPP----PXXPPPPRXPXPPXXP 807 P GGG PP P G P P G PG PP P PPP P P P Sbjct: 211 PQEGGGI--PPQNHPLTNYPAPPPQGYAP-PPGGYPGAPPAGGYPGAPPPGGYPGGP--P 265 Query: 808 PPXAP 822 P P Sbjct: 266 PANYP 270 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGX--PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P G +P G PG PPP P P P PPP PP Sbjct: 157 PPPGTQPPGQGGYPGYNQPPPGHYPAPGQPG-GYYPPPGGYQQPP 200 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +1 Query: 715 GQRPXPXGXXPGXP-PPXXPPPPRXP---XPPXXPPP 813 G +P P P P PP PPPR PP PPP Sbjct: 241 GDKPHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPP 277 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P PPP P PPP AP PP Sbjct: 450 PLPSDEPPPLPPDEEKPPPPPAPALPP 476 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 724 PXPXGXXPGXPPPXX--PPPPRXPXPPXXPPPXAPXXP 831 P P P PP PPPP PP PP P P Sbjct: 450 PLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSP 487 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 32.7 bits (71), Expect = 0.43 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXP-XGXGRWPXXGPXLXPGVAXGXG 669 GG G GG G G GG G GG G P G GR G PG G G Sbjct: 29 GGGMGRGPGGGW-GRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRG 83 Score = 31.5 bits (68), Expect = 0.98 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXG 675 GG G GG G G G GGG G GR P G PG G Sbjct: 37 GGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWG 89 Score = 30.7 bits (66), Expect = 1.7 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 5/69 (7%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGG---XXGGGXPGXXPXGXGRWPXXGPXLXPGVAXG--XGG 666 G G G G GG G GGG GGG G GR G PG G GG Sbjct: 11 GSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGG 70 Query: 665 XXXPPPPXG 639 P G Sbjct: 71 GMGRGPGGG 79 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXGXP 418 G GG G GGG G GG G GGG P Sbjct: 2 GQGPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGP 36 Score = 29.9 bits (64), Expect = 3.0 Identities = 25/75 (33%), Positives = 28/75 (37%), Gaps = 1/75 (1%) Frame = +1 Query: 313 GXGXGGGPPXXR-GGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRXX 489 G G GGG + GG G P G G G GG G R P R++ Sbjct: 17 GQGPGGGWGRGQGGGMGRGPGGGWG-RGSGGGWG---RMQGGGMGRGPGGGWGRMQGGGM 72 Query: 490 XXGGGXGXGXGXGXG 534 G G G G G G G Sbjct: 73 GRGPGGGLGRGPGGG 87 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGGXXGXP 418 + GG G GGG G GG G GGG P Sbjct: 52 QGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGP 84 Score = 29.9 bits (64), Expect = 3.0 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG G G G GGG G GR G PG G G Sbjct: 53 GGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQEGGMGRGPGQGWGCRG 108 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GG G GGG G GG G GGG Sbjct: 22 GGWGRGQGGGMGRGPGGGWGRGSGGG 47 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGGXXGXP 418 + GG G GGG G GG G GGG P Sbjct: 28 QGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGP 60 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GG G GGG G GG G GGG Sbjct: 38 GGWGRGSGGGWGRMQGGGMGRGPGGG 63 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GG G GGG G GG G GGG Sbjct: 14 GGWGQGPGGGWGRGQGGGMGRGPGGG 39 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 32.3 bits (70), Expect = 0.56 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 760 PXXPPPPRXPXPPXXPPP 813 P PPPP P PP PPP Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 Score = 31.5 bits (68), Expect = 0.98 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPP P PP Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPP 810 P PPP PPP P PP P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G GA GGG G G GG G G G G G Sbjct: 418 GSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNG 454 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXG--GXGXRGGGGXXGGGXPGXXPXG 729 GG A GG G G G G GG GGG G G Sbjct: 432 GGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGG 468 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 818 AXGGGXXGGXGXRGGGGXXGGGXPG 744 A GGG GG G GGGG GG G Sbjct: 39 ADGGGGGGGGGGGGGGGGGGGDGDG 63 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGG 753 G GGG GG G GGGG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDG 63 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 A + GGG G GGG G GG G G G Sbjct: 37 ANADGGGGGGGGGGGGGGGGGGGDGDGDGDG 67 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPG 744 G GGG GG G GGGG G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDG 67 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 797 GGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGGG GGG G G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDG 65 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG G G G G G GGGG Sbjct: 52 GGGGGGGGDGDGDGDGDANANADGGGGGGG 81 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 32.3 bits (70), Expect = 0.56 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-PPPPRXPXPPXXPPP 813 AP G P A P P G P P P PPP P P P PPP Sbjct: 503 APSSGVPTTVTAPPAAPPPSVFAPSSGV-PTPVTEPPPAPPPSVFAPSSGVPTPVTAPPP 561 Query: 814 XAP 822 P Sbjct: 562 APP 564 Score = 32.3 bits (70), Expect = 0.56 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-PPPPRXPXPPXXPPP 813 AP G P A P P G P P P PPP P P P PPP Sbjct: 525 APSSGVPTPVTEPPPAPPPSVFAPSSGV-PTPVTAPPPAPPPSVFAPSSAVPTPATAPPP 583 Query: 814 XA 819 A Sbjct: 584 VA 585 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 7/59 (11%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-------XPXPPXXPPPXAP 822 PP TP P P G P P PPP P P PPP P Sbjct: 346 PPPAVPTPATAPPPVVAPPPSVFASSSGVPTPVKAPPPSVFASSSGVPTPVAAPPPAPP 404 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P PPP P P PPP P Sbjct: 332 PPVTEPAPPSSVVAPPPAVPTPATAPPPVVAPPP 365 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGG 753 GGG GG G GGGG GGG Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 796 GGXGXGGGGGXXGGGXRG 743 GG G GGGGG GGG G Sbjct: 320 GGGGGGGGGGGGGGGGGG 337 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 796 GGXGXGGGGGXXGGGXRG 743 GG G GGGGG GGG G Sbjct: 321 GGGGGGGGGGGGGGGGGG 338 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 796 GGXGXGGGGGXXGGGXRG 743 GG G GGGGG GGG G Sbjct: 322 GGGGGGGGGGGGGGGGGG 339 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 32.3 bits (70), Expect = 0.56 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXG 675 GA GG GG G GG GGG P G GR G +A G Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRGVFIARG 89 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +2 Query: 311 AGXEXG-GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 AG G GGP G G G G GG GGG G Sbjct: 42 AGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGG 76 >SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) Length = 185 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 809 GGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG GG G GGGG GGG G G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDG 150 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GGG GG GGG GGG G G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDG 153 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 32.3 bits (70), Expect = 0.56 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGG---GGXXGGGXPGXXPXGXG 723 G GGG GG GG GG GGG PG G G Sbjct: 333 GDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGG 368 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G G G GG G GGG GGG PG G G Sbjct: 325 GGDGDHGDGDHGG-GDPGGG-DPGGGDPGGGDPGGG 358 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGG---GGXXGGGXPGXXPXGXG 723 G GGG GG GG GG GGG G G G Sbjct: 338 GDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGG 373 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGG---GGXXGGGXPGXXPXGXG 723 G GGG GG GG GG GGG G G G Sbjct: 343 GDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDG 378 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGG---GGXXGGGXPGXXPXGXG 723 G GGG GG GG GG GGG G G G Sbjct: 348 GDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGG 383 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 736 GXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 G P PP PPP P PP PPP P Sbjct: 140 GDSPVSSPPRTPPP--EPTPPPTPPPLRP 166 >SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) Length = 772 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG GGG G G GGGG GGG Sbjct: 512 GGGSHEMGGGMEEGAGGMGGGGGAGGG 538 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG GG G G GGGG GGG Sbjct: 513 GGSHEMGGGMEEGAGGMGGGGGAGGGG 539 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 730 PXGXXPGX-PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PG PPP PPP P PP P PP Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPP 243 Score = 31.5 bits (68), Expect = 0.98 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P A PG P G P P G PP PP P PP P P P Sbjct: 209 PNAPPGLM--PPPGMLPPPGGM-----PPGRMPPQGLPFPPPGPIPPPP 250 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +1 Query: 745 PGX-PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PG PPP PP R P PP P PP Sbjct: 219 PGMLPPPGGMPPGRMPPQGLPFPPPGPIPPP 249 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 E GG G GGG G GG G GGG G Sbjct: 367 EGGGRGGGRGGGRGGFRGGRGGRGGGGRGAG 397 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG G GGG G G RGG G G G Sbjct: 369 GGRGGGRGGGRGGFRGGRGGRGGGGRG 395 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -1 Query: 821 GAXGGGXXGGXGX-RGGGGXXGGGXPG 744 G GGG GG G RGG G GGG G Sbjct: 369 GGRGGGRGGGRGGFRGGRGGRGGGGRG 395 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXG-GGXPG 744 GG G GGG G G GGG G GG PG Sbjct: 248 GGIGGLGGGGVIAGAGAGIGGGVIGTGGIPG 278 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 31.9 bits (69), Expect = 0.74 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PPP PP P P PP P P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDP 450 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP P PPP P PP Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 Score = 29.1 bits (62), Expect = 5.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXP 794 P P P PPPPP P P Sbjct: 427 PPPPAPLPPPPPPPPQP 443 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 708 RXXPTARXXGXXPRXPPPXXPPPPPXPXPP 797 R PT PP PPP P P PP Sbjct: 408 RPFPTPNRRRRRSLVQPPPPPPPAPLPPPP 437 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P TP Q P P P PPP PP P P P Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG G G GG G GGGG GGG G G Sbjct: 124 GGQAGGQAGSQAGG-GAAGGGGQEGGGQGGAQAGG 157 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G E GG G GG G GG G GGG G Sbjct: 110 GGEAGGEAGGQAGGGGQA-GGQAGSQAGGGAAG 141 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/30 (53%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = -1 Query: 833 GGXXG--AXGGGXXGGX-GXRGGGGXXGGG 753 GG G A GGG GG G + GGG GGG Sbjct: 114 GGEAGGQAGGGGQAGGQAGSQAGGGAAGGG 143 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGG 756 G G GGG GG G GGGG GG Sbjct: 147 GPVCGRGGGGRRGGGGCCGGGGGGGG 172 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 797 GGXGXRGGGGXXGGGXPG 744 GG G RGGGG GGG G Sbjct: 153 GGGGRRGGGGCCGGGGGG 170 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 Query: 818 AXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 A GGG GG G +GGG GG G G G Sbjct: 1107 AMGGGMGGGMGMQGGGMGMQGGGMGMQDGGMG 1138 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPR-XPXPPXXPPPXAPXXP 831 P P P P PP PP PR P PP P P P Sbjct: 850 PLSPSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +1 Query: 724 PXPXGXXPGXPP-PXXPP-PPRXPXPPXXPPPXA 819 P P G P PP P P PP+ PP P P A Sbjct: 861 PRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAA 894 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGG 756 G G GGG GG G GGGG GG Sbjct: 64 GPVCGRGGGGRRGGGGCCGGGGGGGG 89 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 797 GGXGXRGGGGXXGGGXPG 744 GG G RGGGG GGG G Sbjct: 70 GGGGRRGGGGCCGGGGGG 87 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 724 PXPXGXX--PGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P G P PP PPPP P PPP P Sbjct: 181 PAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 833 GGXXGAXGGG-XXGGXGXRGGGGXXGGGXPG 744 GG G GGG GG G GGGG GG G Sbjct: 14 GGDGGDSGGGSDGGGDGGDGGGGSDGGDGEG 44 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G + GG G GGGG G Sbjct: 9 GDGEGGGDGGDSG--GGSDGGGDGGDGGGGSDG 39 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 G G GG G GGG GGG G G Sbjct: 9 GDGEGGGDGGDSGGGSDGGGDGGDGGGG 36 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGG 756 G G GGG GG G GGGG GG Sbjct: 147 GPVCGRGGGGRRGGGGCCGGGGGGGG 172 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 797 GGXGXRGGGGXXGGGXPG 744 GG G RGGGG GGG G Sbjct: 153 GGGGRRGGGGCCGGGGGG 170 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 31.5 bits (68), Expect = 0.98 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 4/59 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXX-GQRPXPXGXXPGXPPPXXPPPP---RXPXPPXXPPPXAPXXP 831 PP P P GP P P PP PPPP P PP P P Sbjct: 50 PPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPPFIVDDTESPQEQPPTTPVSP 108 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPK 420 G G G G GG G +P G G G GG G P+ Sbjct: 1274 GGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPR 1309 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G GA GGG G G GGG G G G G Sbjct: 513 GDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGGG 548 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G + GGG G G G + GG GGGG Sbjct: 526 GGDNGGGDDGGDDGAGNSDGGGGNDNGGGG 555 >SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1021 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/63 (28%), Positives = 18/63 (28%), Gaps = 1/63 (1%) Frame = +1 Query: 649 GGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP-XPPXXPPPXAPX 825 G PP P P G P P P P P P P P P P Sbjct: 761 GSSVRSPPPPYPGSRTSGNPHMGSSPAPIPSPTSTGSPQTPLTPHTPRFPNTAPSPGEPN 820 Query: 826 XPP 834 PP Sbjct: 821 KPP 823 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG GA GGG GG G GG G G P G Sbjct: 490 GGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGG 526 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGG 756 G G GG GG G GGGG GG Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 335 PXGXGGGXGXTXGGXXGXXGGGGXXG 412 P G GGG G + GG G GGG G Sbjct: 486 PGGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 809 GGXXGGXGXRGGGGXXGGG 753 GG GG G GGGG GGG Sbjct: 487 GGFGGGGGASGGGGGGGGG 505 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPG 744 G GGG GG GGGG GGG G Sbjct: 487 GGFGGG--GGASGGGGGGGGGGGFSG 510 >SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 31.5 bits (68), Expect = 0.98 Identities = 17/55 (30%), Positives = 20/55 (36%) Frame = -1 Query: 536 PPXPWPXPXPXPPPXXXXRDLSRGVXGXGGAXRXSGGXLLGXPXAPPPPXXPXXP 372 PP P P P PP + + G G G + P APP P P P Sbjct: 101 PPMPLAPPVPLAPPMPLAPPVQQAPCGAGPMQAPCAGQQM--PLAPPMPLAPPVP 153 Score = 29.9 bits (64), Expect = 3.0 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = +1 Query: 667 PPXPXATP--GXXXGPXXGQRPXPXGXXPGXPP-PXXPPPPRXPXPPXXPP 810 PP P A P G Q P P PP P PP P P P PP Sbjct: 70 PPMPLAPPVQQAPCGAGTMQAPCAGQQMPLAPPMPLAPPVPLAPPMPLAPP 120 >SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) Length = 260 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GGG GG G GGG GGG Sbjct: 148 GPVRGRGGGGRGGGRGHGRGGGSGGGG 174 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +1 Query: 754 PPPXXPPPPRXPX-PPXXPPPXAPXXP 831 PPP P P P PP PPP P P Sbjct: 2628 PPPGLPMQPEAPVQPPPLPPPGGPFPP 2654 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPP--PPRXPXPPXXPP--PXAPXXPP 834 Q P P P PP P PP P PP P P AP PP Sbjct: 2601 QLPPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPP 2643 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P + P P P P PPR P P P P PP Sbjct: 321 PPSPIRYP-----PLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPP 371 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P P P + P P PP P PPR P P PP P Sbjct: 265 PPSPLRYP-----PIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYP 314 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 769 PPPPRXPXPPXXPPPXAPXXPP 834 P PPR P P PP P PP Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPP 280 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 31.5 bits (68), Expect = 0.98 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P PP+ P PP AP PP Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPP 773 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P PP P PP P PPP AP P Sbjct: 751 PPLPPKVTPKPPAPPQFAPVPPPCAPIPP 779 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 P P P P P P P PP P P PPP A Sbjct: 769 PVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPPPVA 816 Score = 29.1 bits (62), Expect = 5.2 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP---RXPXPPXXPP-PXAPXXPP 834 PP P P P P P P PPP P PP P PP P AP PP Sbjct: 748 PPAPPLPPKVTPKP-----PAPPQFAP-VPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPP 801 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG GG GG PG P G G P P G+ G GG Sbjct: 176 GGFPGGMPGGMPGGMP---GGFPGAGGMPGGFP-GAGGMPGGFPGAG-GMPGGPGG 226 >SB_45113| Best HMM Match : CemA (HMM E-Value=6) Length = 363 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXP 747 G G GGG GG G GGGG G P Sbjct: 148 GPMRGRGGGGRRGGRGRGGGGGGGEGDCP 176 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 724 PXPXGXXPGXP--PPXXPPPPRXPXPPXXP---PPXAPXXPP 834 P P P P PP P PP P P P PP P PP Sbjct: 518 PTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPP 559 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P P P P P P PP P PP Sbjct: 198 PSYPPTAPSYP--PTPSSYPPIAASYPPTAPSYNPTAPSYPPTPSSYPPTQPSHPP 251 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +1 Query: 718 QRPXPXGXXPGXPP--PXXPPPPRXPXPPXXP--PPXAPXXPP 834 Q P P PP P PP P PP P PP AP PP Sbjct: 168 QHPSYPPTQPFYPPTQPFYPPTPSS-YPPTQPSYPPTAPSYPP 209 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 31.1 bits (67), Expect = 1.3 Identities = 27/70 (38%), Positives = 28/70 (40%) Frame = +1 Query: 325 GGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRXXXXGGG 504 GGGPP RGG P G G GG+ G P R P R PP R R GG Sbjct: 493 GGGPP--RGG----PRG-----GRGGSRGGPPRGAPRGRSGPP-------RGRGGGDFGG 534 Query: 505 XGXGXGXGXG 534 G G G Sbjct: 535 RGGRGGTTPG 544 Score = 30.3 bits (65), Expect = 2.3 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG G G RGG G GG P P G P G G GG Sbjct: 486 GGYDDYYGGGPPRG-GPRGGRGGSRGGPPRGAPRGRSGPPRGRGGGDFGGRGGRGG 540 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGG 397 G GGGP G GG G GG G GG Sbjct: 439 GGPRGGGPRGYDGGYG-QGGGYEGYSGG 465 >SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) Length = 627 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 PR PP P PPP P PP Sbjct: 157 PRHSPPQTPVPPPPPLPP 174 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 717 PTARXXGXXPRXPPPXXPPPPPXPXPP 797 PT P+ PP PPPPP PP Sbjct: 346 PTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P Q P P P P PPPP P PP PPP Sbjct: 340 PTTPQPPTPT--TPKTHPQLGPPPP-PPPPPPTPPP 372 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPX---PPXXPPPXAPXXPP 834 P +TP P P P P P P P+ PP PPP P PP Sbjct: 321 PDSTPATNAPPSDS----PSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 796 GGXGXGGGGGXXGGGXRG 743 GG G GGGGG GGG G Sbjct: 419 GGGGRGGGGGDGGGGGEG 436 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GGG GG G GGGG G P GR Sbjct: 420 GGGRGGGGGDGGGGGEGVQGTPYTPEEEEGR 450 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P PPP P P PP PPP A PP Sbjct: 375 PAMFNPHVPPPMIGPVT-VPPPPLIPPPQASIPPP 408 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPP----XXPPPXAPXXP 831 P G PPP PPP PP PPP P P Sbjct: 384 PPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPP 423 >SB_17315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 405 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +1 Query: 331 GPPXXRGGXGXD-PXGXXGXXGGGGAXGXPKRXPPEXRXAPP 453 GPP GG G + P G G G G G P + P PP Sbjct: 28 GPPGLAGGVGANGPSGRGGSQGPPGPPGAPGQPGPRGIKGPP 69 Score = 29.9 bits (64), Expect = 3.0 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +2 Query: 248 GLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXG-GXXGXXGGGGXXG 412 G + GPP PP P G GP G GG G G G GG G G Sbjct: 43 GRGGSQGPPGPPGAP----GQPGPRGIKGPPGRAGGTGLMGYLGEPGVVGGAGPKG 94 >SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +2 Query: 266 GPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXGXP 418 GPP PP PP G G G G G G G G G G G P Sbjct: 186 GPPGPPGPP-----------GPGLVGSGSGAGAVIAGPPGPPGPPGPPGPP 225 >SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1853 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +2 Query: 266 GPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXGXP 418 GPP PP PP G + GP G G G G G G G G P Sbjct: 843 GPPGPPGPPGVT-GEQGVKGDTGPSGEPGPAGPP--GPLGTPGTQGAKGEP 890 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAP 822 P PPP PPP P PPP P Sbjct: 363 PTPPPPPHSPPPPLPVIQLNPPPARP 388 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/49 (28%), Positives = 15/49 (30%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P P + P P P P P P P PPP P Sbjct: 636 PEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPKPHIPPAPSRPPPQLP 684 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P P P P P P PP P P PP PP + P Sbjct: 640 PSLPGTPPETKTKPPLAPYP-PKTSPKTTPKPHIPPAPSRP-PPQLPPEASKAVP 692 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG G G GGGG GG G G Sbjct: 468 GGFGG--GGGPNGAGGGGGGGGGYSGGASGSRSNSCG 502 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXG 394 G GGGP G GGG G G G G Sbjct: 469 GFGGGGGPNGAGGGGGGGGGYSGGASG 495 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +1 Query: 754 PPPXXPPPP---RXPXPPXXPPPXAP 822 PPP PPPP PP PPP P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNP 30 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P ++ P Q P PG P P P P PP PPP P Sbjct: 979 PPSSQPSMYNPGQVQPGYPGAMTPGAPSPGVPSP--TGLPPSGPPPTGP 1025 Score = 29.9 bits (64), Expect = 3.0 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 655 GXXXPPXPXA-TPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP 789 G P P A TPG P G P P G P PPP PP P Sbjct: 990 GQVQPGYPGAMTPG---APSPGV-PSPTGLPPSGPPPTGPPADGDP 1031 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 8/38 (21%) Frame = +1 Query: 745 PGXPPP-XXPP---PPRXPXP----PXXPPPXAPXXPP 834 PG PPP PP PPR P P P P P P PP Sbjct: 373 PGMPPPGLLPPPGMPPRLPIPGLGLPGMPLPGMPGMPP 410 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 5/32 (15%) Frame = +1 Query: 730 PXGXXPGXPP-----PXXPPPPRXPXPPXXPP 810 P G PG PP P PPP P PP PP Sbjct: 358 PQGLPPGMPPMALSLPGMPPPGLLP-PPGMPP 388 >SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +2 Query: 245 RGLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXG-GXXGXXGGGGXXGXP 418 +GL GPP P PP G GP G G G G G G G G P Sbjct: 78 KGLNGPPGPPGAPGPPGEP-GQVGMAGPPGPPGHVGEDGAPGAPGAPGPPGSPGAPGLP 135 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 655 GXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 G PP P PG P P G P P P PP P AP P Sbjct: 79 GLNGPPGPPGAPGPPGEPGQVGMAGPPGPPGHVGEDGAPGAPGAPGPPG--SPGAPGLP 135 Score = 28.3 bits (60), Expect = 9.2 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 7/65 (10%) Frame = +1 Query: 286 PPXXXVKXSGXGXGG--GPPXXRGGXGX-----DPXGXXGXXGGGGAXGXPKRXPPEXRX 444 PP + G G GPP G G DP G G G G G P P+ Sbjct: 107 PPGHVGEDGAPGAPGAPGPPGSPGAPGLPGEKGDP-GLQGAPGAAGLPGAPGLPGPQGPM 165 Query: 445 APPXP 459 PP P Sbjct: 166 GPPGP 170 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/61 (29%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP--PPPRXPXPPXXPPPXA 819 G G P P +PG P P G P P P P+ P P P P Sbjct: 115 GAPGAPGAPGPPGSPGAPGLPGEKGDPGLQGAPGAAGLPGAPGLPGPQGPMGPPGPEPIM 174 Query: 820 P 822 P Sbjct: 175 P 175 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G + GGG G G G GG G GGG G Sbjct: 447 GGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGG 479 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGG 756 G G GGG GG G GGG GG Sbjct: 460 GIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXG 411 G G GGG G G D G G GGG G Sbjct: 452 GGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGG 768 GG G GGG GG G GGG Sbjct: 463 GGDGGGDGGGDGGGDGGGDGGG 484 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GG P G G G GG G GGGG Sbjct: 371 GGEPGAFGSGSGFGGGGSSGGGGGGG 396 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGG 756 GG GA G G G G GGG GG Sbjct: 371 GGEPGAFGSGSGFGGGGSSGGGGGGG 396 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 756 PPXXPPPPPXPXPP 797 PP PPPPP P PP Sbjct: 162 PPPQPPPPPLPPPP 175 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPPP P PP Sbjct: 162 PPPQPPPPPLPPPPP 176 Score = 28.7 bits (61), Expect = 6.9 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 744 PRXPPPXXPPPPP 782 P+ PPP PPPPP Sbjct: 164 PQPPPPPLPPPPP 176 Score = 28.3 bits (60), Expect = 9.2 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 772 PPPRXPXPPXXPPP 813 PPP+ P PP PPP Sbjct: 162 PPPQPPPPPLPPPP 175 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 536 PPXPWPXPXPXPPPXXXXRDLS 471 PP P P P P PPP D+S Sbjct: 163 PPQPPPPPLPPPPPPIDLVDMS 184 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 +P GG PP P PG G P G G P PPPP P PPP Sbjct: 605 SPPHGGHPHHPP-PTGYPGGYPGTHTAP---PAG---GYPTGQHPPPPPAGYPGYGPPP 656 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 753 PPPXXPPPPPXPXP 794 PPP PPPPP P P Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 756 PPXXPPPPPXPXPP 797 PP PPPPP P PP Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 28.7 bits (61), Expect = 6.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 Query: 747 RXPPPXXPPPPPXP 788 + PPP PPPPP P Sbjct: 210 KPPPPPPPPPPPPP 223 >SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) Length = 245 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 421 FWGPXXPPPPXXPXXXPXGPAXXPPSXXGAP 329 F P PPPP P P P PP G P Sbjct: 183 FQYPGTPPPPMYPAFPPSFPFSPPPEYPGLP 213 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPP 810 PPP PPPP P PP PP Sbjct: 142 PPP--PPPPPSPPPPCHPP 158 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 769 PPPPRXPXPPXXPPPXAPXXPP 834 PPPP P PP PPP P P Sbjct: 142 PPPP--PPPPSPPPPCHPPALP 161 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GGG G G GGGG GG G Sbjct: 226 GGFGG--GGGVWGNGGGGGGGGGYSGGGSG 253 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXGXPKXXP 430 G P G GGG G G G GGGG G P Sbjct: 223 GVPGGFGGG-GGVWGNGGGGGGGGGYSGGGSGNP 255 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PP PP P PP Sbjct: 32 PPPSPPPSPPPPSPP 46 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PP PP P PP Sbjct: 155 PPPSPPPSPPPPSPP 169 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 30.3 bits (65), Expect = 2.3 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP-XPPXXP--PPXAPXXPP 834 PP P G + P PG PP PP P PP P PP P PP Sbjct: 318 PPHDQGRPPYEPGRPPHEPGRPP-HEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 375 Score = 30.3 bits (65), Expect = 2.3 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP-XPPXXP--PPXAPXXPP 834 PP P G + P PG PP PP P PP P PP P PP Sbjct: 325 PPYEPGRPPHEPGRPPHEPGRPP-HEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 382 Score = 30.3 bits (65), Expect = 2.3 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP-XPPXXP--PPXAPXXPP 834 PP P G + P PG PP PP P PP P PP P PP Sbjct: 332 PPHEPGRPPHEPGRPPHEPGRPP-HEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPP 389 Score = 30.3 bits (65), Expect = 2.3 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP-XPPXXP--PPXAPXXPP 834 PP P G + P PG PP PP P PP P PP P PP Sbjct: 339 PPHEPGRPPHEPGRPPHEPGRPP-HEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 396 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGG 403 GGP G GGG G GG G G G Sbjct: 206 GGPRGGGGGSGGYGGGSYGGYGNYG 230 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 304 KXSGXGXGG-GPPXXRGGXGXDPXGXXGXXGGGGAXG 411 K + G GG G RGG P G G GGGG G Sbjct: 180 KAADLGAGGRGGRGGRGGGRGAPRGRGGPRGGGGGSG 216 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 833 GGXXGAXGG-GXXGGXGXRGGGGXXGGGXPGXXPXGXGRW 717 GG G GG G G G GGG GG G G G + Sbjct: 190 GGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNY 229 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG G GGG G G GGGG G Sbjct: 190 GGRGGRGGGRGAPRGRGGPRGGGGGSGG 217 >SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) Length = 532 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GGG GG G RG GG GGG Sbjct: 318 GPVRGRGGGGRGGGRG-RGRGGSGGGG 343 >SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) Length = 792 Score = 30.3 bits (65), Expect = 2.3 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 4/61 (6%) Frame = +1 Query: 640 PXGGGGXXX----PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP 807 P G GG PP PG P G P P PG PP P R P P P Sbjct: 239 PMGHGGPPMDRGGPPMMHGGPGPRM-PHSGPEPVP----PGGPPMQGGPNMRGPHPRMDP 293 Query: 808 P 810 P Sbjct: 294 P 294 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 754 PPPXXPP-PPRXPXPPXXPPPXAPXXPP 834 PPP PP PP P P PP P P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +1 Query: 745 PGXPPPXXPP-PPRXPXPPXXPPPXAP 822 P PPP PP PP PP PP P Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 30.3 bits (65), Expect = 2.3 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP-XPPXXP--PPXAPXXPP 834 PP P G + P PG PP PP P PP P PP P PP Sbjct: 84 PPHDQGRPPYEPGRPPHEPGRPP-HEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 141 Score = 30.3 bits (65), Expect = 2.3 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP-XPPXXP--PPXAPXXPP 834 PP P G + P PG PP PP P PP P PP P PP Sbjct: 91 PPYEPGRPPHEPGRPPHEPGRPP-HEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 148 Score = 30.3 bits (65), Expect = 2.3 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP-XPPXXP--PPXAPXXPP 834 PP P G + P PG PP PP P PP P PP P PP Sbjct: 98 PPHEPGRPPHEPGRPPHEPGRPP-HEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPP 155 Score = 30.3 bits (65), Expect = 2.3 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP-XPPXXP--PPXAPXXPP 834 PP P G + P PG PP PP P PP P PP P PP Sbjct: 105 PPHEPGRPPHEPGRPPHEPGRPP-HEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 162 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAP 822 PPP PPP P PPP P Sbjct: 583 PPPHPPPPAHHVNKPGVPPPPPP 605 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P PPP P PP Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPPPPPP 387 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +3 Query: 717 PTARXXGXXPRXP--PPXXPPPPPXPXP 794 PT P P PP PPPPP P P Sbjct: 363 PTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGG 397 AG GG G GG G GG G GG Sbjct: 794 AGSSSGGASGGAGGSSGGASGGAGGSSGG 822 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G+ GG G GG GG G G G Sbjct: 781 GGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAG 817 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG + GG G G GG GG G G G Sbjct: 792 GGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAG 828 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGG--GGXXG 412 AG GG G GG G GG GG GG G Sbjct: 772 AGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGG 807 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGG--GGXXG 412 AG GG G GG G GG GG GG G Sbjct: 805 AGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADG 840 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 G GA GG G GG G GG G G + Sbjct: 807 GSSGGASGGAGGSSGGASGGAGSSSGGASGGADGGSNK 844 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGG--GGXXG 412 AG GG G G G GG G GG GG G Sbjct: 783 AGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGG 818 >SB_58049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 G G P PG P P P G G P P P P PP P Sbjct: 265 GAPGFPGAPGFQGPPGLDGMPGAPGMPGPQGYPGGSGAPGIPGSPGMPGPPGPAGP 320 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PP PP PP PP P PP Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDPP 55 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +1 Query: 757 PPXXPP-PPRXPXPPXXPPP 813 PP PP PP P PP PPP Sbjct: 29 PPEAPPLPPFAPLPPPVPPP 48 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 29.9 bits (64), Expect = 3.0 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +1 Query: 637 APXGGGGXXXPPX--PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP 798 AP GG PP P P G G+ P P PP P PPR PP Sbjct: 64 APRRGGYGGGPPRGPPRGHPMRGRGAPYGRGGPPSRGPPRGPP--LPGPPRRGPPP 117 >SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGG 771 GG G GGG GG G GGG Sbjct: 187 GGGGGTTGGGGSGGEGTTGGG 207 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPG 744 G GGG GG G GG G GGG G Sbjct: 186 GGGGGGTTGGGGS-GGEGTTGGGVSG 210 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG G G G G GGGG GGG Sbjct: 259 GGFGGGGGACGCNGGGAGGGGGYSGGG 285 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 793 GXGXGGGGGXXGGGXR 746 G G GGGGG GGG R Sbjct: 272 GGGAGGGGGYSGGGLR 287 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPP 810 PP PPPPR P PP PP Sbjct: 74 PPQPTPPPPRPPTPP--PP 90 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 748 GXPPPXXPPPPRXPXPPXXPPP 813 G PP PPP P PP PPP Sbjct: 71 GSTPPQPTPPP--PRPPTPPPP 90 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 690 RXQXRXRXXPTARXXGXXPRXPPPXXPPPPP 782 R + R P G PPP PPPPP Sbjct: 775 RDRNESRYKPEGEGVGGITPPPPPPPPPPPP 805 Score = 28.3 bits (60), Expect = 9.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 753 PPPXXPPPPPXP 788 PPP PPPPP P Sbjct: 794 PPPPPPPPPPPP 805 >SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) Length = 346 Score = 29.9 bits (64), Expect = 3.0 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +1 Query: 655 GXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX---PPPPRXPXPPXXPPPXAPX 825 G PP P T G P Q PG P P P PP P P P P Sbjct: 45 GTEGPPGPQGTKG----PPGSQGLSGVQGYPGAPGPRGRSPPGPPGIPGPRGLPGYRGPK 100 Query: 826 XPP 834 PP Sbjct: 101 GPP 103 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP 810 PP P PG P P G G P P PR P P PP Sbjct: 81 PPGPPGIPGPRGLPGYRGPKGPPGYQ-GMPGIAGAPGPRGPPGPMGPP 127 >SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGG 403 G G GGG G T GG G GGGG Sbjct: 189 GASAGGGGGVG-TTGGSTGAAGGGG 212 >SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1414 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 748 GXPPPXXPPPPRXPXPPXXPP 810 G PPP PPPR P PP Sbjct: 879 GSPPPPMAPPPRSASPNHRPP 899 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G E GGG G GG GG G GGGG G Sbjct: 79 GCEGGGGSGGCEGG-----GGCVGCEGGGGCVG 106 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P G P P PPPPR PP AP Sbjct: 220 PPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPX-PXGXXPGXPPPXXPPPPRXPXPP 798 PP P GP Q P PG P P PP P P PP Sbjct: 3796 PPGPPGRSKNISGPPGPQGPPGQASQIPGPPGPQGPPGP--PGPP 3838 Score = 29.1 bits (62), Expect = 5.2 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -1 Query: 830 GXXGAXG-GGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 G G G G GG G RG G G P G GP PG+A G Sbjct: 3686 GDKGERGFPGNNGGKGERGAQGPRGEKGNTGAPGSQGSTGPRGPIGQPGMAGSQG 3740 >SB_9191| Best HMM Match : TolA (HMM E-Value=1) Length = 541 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 748 GXPPPXXPPPPRXPXPPXXPP 810 G PPP PPPR P PP Sbjct: 69 GSPPPPMAPPPRSASPNHRPP 89 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGG 403 G G GGG G T GG G GGGG Sbjct: 235 GASAGGGGGVG-TTGGSTGAAGGGG 258 >SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) Length = 253 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXG 705 GGG GG G GGGG GGG R P G Sbjct: 164 GGG--GGGGGGGGGGRRGGGSMSPPRRSRSRSPRRG 197 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = +1 Query: 346 RGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSR 483 RGG G G G GGG+ P+R +PR RSR Sbjct: 163 RGGGGGGGGGGGGGRRGGGSMSPPRRSRSRSPRRGGRGGSPRQRSR 208 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGG 771 G GGG GG G RGGG Sbjct: 165 GGGGGGGGGGGGRRGGG 181 >SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2492 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG GG G GGG G Sbjct: 1211 GGSDGGGDGGYGGIDSGGDGGCDGGIDGGGDGG 1243 >SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1271 Score = 29.5 bits (63), Expect = 4.0 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = +2 Query: 248 GLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXG-GXXGXXGGGGXXGXP 418 GL GP PP PP G GP G G G G G G G G P Sbjct: 1025 GLMGRSGPVGPPGPPGSP-GDRGQTGVPGPVGPDGDIGAPGADGVPGPKGPPGPPGYP 1081 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 29.5 bits (63), Expect = 4.0 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 G GGG G RGG G G G G GR G + G G G Sbjct: 62 GMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGGGGMAGEG 112 Score = 29.1 bits (62), Expect = 5.2 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GGG G RGG G G G G GR G + G G G Sbjct: 40 GGRMG--GGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEG 92 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 G GGG G RGG G G G G GR G + G G G Sbjct: 102 GMGGGGMAGEGMSRGGIAGEGMGRGGMAGEGMGRGGMAGEGMGGGGMAGEG 152 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPP 813 P PPP PP P PP P P Sbjct: 1262 PPLPPPDAQPPSLPPQPPQPPQP 1284 >SB_36009| Best HMM Match : Collagen (HMM E-Value=0) Length = 687 Score = 29.1 bits (62), Expect = 5.2 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = -1 Query: 830 GXXGAXGG-GXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP 654 G GA G G G G +G G G G P G GP PG G P Sbjct: 430 GAPGAQGERGPRGEQGKQGEKGHAGEGGADGAPGIPGEQGPMGPVGAPGPVGNAGSPGSP 489 Query: 653 PP 648 P Sbjct: 490 GP 491 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 418 WGPXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 W PPPP P P P PP G PP Sbjct: 191 WTSVPPPPPPGPGGIPPPP---PPIRGGVPP 218 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P P P G PPP PPP R PP PPP Sbjct: 190 PWTSVPPPPPPGPGGIPPP--PPPIRGGVPP--PPP 221 >SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 818 AXGGGXXGGXGXRGGGGXXGG 756 A GGG GG G GG G GG Sbjct: 18 ASGGGGLGGSGGSGGSGGSGG 38 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +1 Query: 667 PPXPXATP--GXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP 810 PP P A P P PG PP PPP P PP PP Sbjct: 139 PPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAP-PPAYPP 187 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PPP PPPP P PPP P PP Sbjct: 755 PPP--PPPPAVPGEGARPPP--PPPPP 777 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 421 FWGPXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 F P PPPP P P PP PP Sbjct: 306 FTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPP 337 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP PP P P PPP P P Sbjct: 297 PPPAPPLPNFTSPSPPPPPPLPPAMP 322 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAP 450 G G GGG GG G G GG PP R P Sbjct: 472 GSGYGGGSSSRGGGGGRSSSGGNSRSGGSSYKSSNPPPPPPPRNQP 517 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +1 Query: 745 PGXPPPXXPPPP-RXPXPPXXPPPXAP 822 P PP PPPP P PP PP P Sbjct: 81 PPPPPIYMPPPPVYMPPPPVYMPPPMP 107 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PPP PP P PP P + PP Sbjct: 158 PPPSSSPPLSSPPPPPPSTPSSSLLPP 184 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 721 RPXPXGXXPGXPPPXXP--PPPRXPXPPXXPPPXAPXXPP 834 RP G PG PPP P P PP PP P Sbjct: 217 RPGGPGMPPGGPPPFPPTSDPNMGHHPPISGPPTTSMSGP 256 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 28.7 bits (61), Expect = 6.9 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRP-XPXGXXPGXPPPXXPP--PPRXPXP 795 P G G PP T G G RP P P P P PP P P P Sbjct: 326 PRGDRGPRGPPSGVPTSGGPPPGHQGLRPSGPNNQGPPGPGPNMPPVSGPSNPAP 380 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXP 795 P P P PPP PPP R P P Sbjct: 1355 PPPHSRLP-LPPPKLPPPSRIPLP 1377 >SB_36007| Best HMM Match : Collagen (HMM E-Value=9e-25) Length = 311 Score = 28.7 bits (61), Expect = 6.9 Identities = 33/114 (28%), Positives = 33/114 (28%), Gaps = 2/114 (1%) Frame = -1 Query: 830 GXXGAXGG-GXXGGXGXRGGGGXXGG-GXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXX 657 G G G G GG G G G G G PG R P GP G G G Sbjct: 94 GKRGPEGDPGSPGGSGEAGDKGVDGPPGSPGPQGFNGARGPN-GPKGDSG-RPGQDGRQG 151 Query: 656 PPPPXGAXXAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPXPWPXPXPXPPP 495 PP P GA PP P P P P P P Sbjct: 152 PPGPPGARGEPGQQAPMMIQVSRPGPNKG-----------PPGPGPGPGPGPAP 194 Score = 28.7 bits (61), Expect = 6.9 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQ--RPXPXGXXPGXPPPXXPPPPRXPXPPXXP-PPX 816 G G PP PG P Q RP P PG P P P P P P P Sbjct: 148 GRQGPPGPPGARGEPGQQ-APMMIQVSRPGPNKGPPGPGPGPGPGPAPGPGPIVQPVVPV 206 Query: 817 APXXP 831 P P Sbjct: 207 QPVIP 211 >SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1995 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 270 PPXPXPPPXPXKTKRXXKXGGAPXXEGGXXAGPXGXXXGXXGGGGXXGP 416 P P P KR G P GG GP GG GP Sbjct: 527 PAAAAPASKPAPVKRPAAKKGPPKPSGGASKGPPKKKPAVKAGGKKAGP 575 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP 795 PP P + P G R P G PG PPP PPPP P Sbjct: 115 PPAPTSVPS-------GPRAPPGG--PGAPPP--PPPPAVVPP 146 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 735 GXXPRXPPPXXPPPPPXP 788 G P PP PPPPP P Sbjct: 168 GPNPSPPPSGAPPPPPPP 185 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G G G G GGG GGG G G G Sbjct: 311 GDGDGDGDGDGDGDGDGDGGGGDGGGDDGGDGDGDG 346 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GG G G GGGG GGG G Sbjct: 625 GGMFGTPGGQQSGFHGGIGGGGM-GGGFSG 653 >SB_45391| Best HMM Match : DUF1509 (HMM E-Value=1.9) Length = 402 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRXPXPP 798 G RP P PPP PP P P P Sbjct: 230 GNRPTPQTEDNPGPPPVYPPNPPEPYSP 257 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G GGG G G GGG GG G G G Sbjct: 2 GYDGGGGDGDGGDGDGGGGGDGGGDGGDCDGDG 34 >SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 635 Score = 28.7 bits (61), Expect = 6.9 Identities = 19/54 (35%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -1 Query: 797 GGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPG-VAXGXGGXXXPPPPXG 639 GG G +G G G P P GR+ GP PG G G P P G Sbjct: 465 GGRGPQGVRGDRGPPGPAGPPGPSGRY-VPGPPGPPGRTVIGLPGPPGPAGPRG 517 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR 783 P G G PP P PG G P G P P P PR Sbjct: 469 PQGVRGDRGPPGPAGPPGPSGRYVPGPPGPPGRTVIGLPGPPGPAGPR 516 >SB_56738| Best HMM Match : Extensin_2 (HMM E-Value=0.076) Length = 869 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 747 RXPPPXXPPPPPXPXPP 797 R PP PPPPP PP Sbjct: 70 RPPPVFIPPPPPDDIPP 86 >SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) Length = 362 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GGG GG G G GG GGG Sbjct: 148 GPVRGRGGGGRGGGRG-HGRGGSGGGG 173 >SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 G G GGG GGGG GGG G G Sbjct: 216 GWENGGFGGGGSAMAHPGGGGGYSGGGIEGSETTG 250 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXP-PPXAPXXP 831 P P G P PP PP P PP P P P P Sbjct: 36 PIPHGPRP-LPPLREPPTPAPTPPPALPSTPTLPLAP 71 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GGG GG G GGGG G G G Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTGGAAFG 3725 >SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXP 795 P P P PP PPPR P P Sbjct: 291 PTPKPRTPTPSPPTPTPPPRSPTP 314 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GGG GGGG GGG Sbjct: 354 GGFGGGGGGSEDNGASGGGGGYSGGG 379 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GGG GGGG GGG Sbjct: 273 GGFGGWGGGSEDNGASGGGGGYSGGG 298 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 747 RXPPPXXPPPPPXPXPP 797 R PP PPPPP PP Sbjct: 196 RPPPSGAPPPPPIGAPP 212 >SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) Length = 279 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GGG GG G G GG GGG Sbjct: 65 GPVRGRGGGGRGGGRG-HGRGGSGGGG 90 >SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2409 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPP 810 PPP PPP PP PP Sbjct: 1749 PPPSHPPPSSLGSPPPSPP 1767 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 769 PPPPRXPXPPXXPPPXAP 822 P PPR P PP PP P Sbjct: 1915 PTPPREPTPPPPPPTPLP 1932 >SB_36777| Best HMM Match : VWA (HMM E-Value=0) Length = 1303 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 G G GGG GG GG G GG G Sbjct: 1096 GGTGVGGGGAAGGGMVTGGAGINVGGSAG 1124 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/55 (30%), Positives = 19/55 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P +TP +R P P PP P PR P P P P P Sbjct: 115 PTPPFSTPRPRPKAKRIRRLLPTPPPP--TPPQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 717 PTARXXGXXPRXPPPXXPPPPPXPXPP 797 PT PR P PP PP P PP Sbjct: 141 PTPPQSTPKPRRVLPTPPPKPPTPRPP 167 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GGG GGGG GGG Sbjct: 224 GGFGGGGGGSEDNGASGGGGGYSGGG 249 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXR---GGGGXXGGGXPGXXPXGXGRWPXXG 705 G G GG GG G GGGG GGG G G + G Sbjct: 174 GGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGGG 218 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.313 0.156 0.564 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,142,040 Number of Sequences: 59808 Number of extensions: 387023 Number of successful extensions: 12357 Number of sequences better than 10.0: 233 Number of HSP's better than 10.0 without gapping: 952 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5777 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2645618622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits)
- SilkBase 1999-2023 -