BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C10 (914 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 48 1e-05 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 48 1e-05 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 47 2e-05 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 44 1e-04 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 44 1e-04 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 44 2e-04 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 43 2e-04 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 43 2e-04 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 42 4e-04 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 42 4e-04 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 42 4e-04 At5g46730.1 68418.m05757 glycine-rich protein 42 6e-04 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 42 8e-04 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 41 0.001 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 41 0.001 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 41 0.001 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 41 0.001 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 41 0.001 At1g61080.1 68414.m06877 proline-rich family protein 41 0.001 At4g01985.1 68417.m00265 expressed protein 40 0.002 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 40 0.002 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 40 0.002 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 40 0.002 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 40 0.002 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 40 0.002 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 40 0.002 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 40 0.002 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 40 0.002 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 40 0.002 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 40 0.002 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 40 0.002 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 40 0.002 At1g53625.1 68414.m06096 expressed protein 40 0.003 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 40 0.003 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 39 0.004 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 39 0.004 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 39 0.005 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 39 0.005 At2g30560.1 68415.m03722 glycine-rich protein 39 0.005 At1g75550.1 68414.m08780 glycine-rich protein 39 0.005 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 39 0.005 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 38 0.007 At4g33660.1 68417.m04781 expressed protein 38 0.007 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 38 0.007 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 38 0.007 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 38 0.007 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 38 0.012 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 38 0.012 At4g30460.1 68417.m04325 glycine-rich protein 38 0.012 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 38 0.012 At2g05440.2 68415.m00575 glycine-rich protein 38 0.012 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 37 0.016 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 37 0.016 At3g24550.1 68416.m03083 protein kinase family protein contains ... 37 0.016 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 37 0.016 At1g26150.1 68414.m03192 protein kinase family protein similar t... 37 0.016 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 37 0.021 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 37 0.021 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 37 0.021 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 37 0.021 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 37 0.021 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 37 0.021 At4g08230.1 68417.m01358 glycine-rich protein 37 0.021 At1g23540.1 68414.m02960 protein kinase family protein contains ... 37 0.021 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 36 0.028 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 36 0.028 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 36 0.028 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 36 0.037 At4g18570.1 68417.m02749 proline-rich family protein common fami... 36 0.037 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 36 0.037 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 36 0.037 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 36 0.037 At1g27710.1 68414.m03387 glycine-rich protein 36 0.037 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 36 0.049 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 36 0.049 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 36 0.049 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 36 0.049 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 36 0.049 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 36 0.049 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 36 0.049 At2g05510.1 68415.m00583 glycine-rich protein 36 0.049 At1g10620.1 68414.m01204 protein kinase family protein contains ... 36 0.049 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 28 0.058 At3g50180.1 68416.m05486 hypothetical protein 35 0.065 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 35 0.065 At2g05440.1 68415.m00574 glycine-rich protein 35 0.065 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 35 0.065 At1g29380.1 68414.m03592 hypothetical protein 35 0.065 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 35 0.065 At1g11850.2 68414.m01364 expressed protein 35 0.065 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 33 0.075 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 35 0.086 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 35 0.086 At5g38560.1 68418.m04662 protein kinase family protein contains ... 35 0.086 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 35 0.086 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 35 0.086 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 35 0.086 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 35 0.086 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 35 0.086 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 35 0.086 At2g05530.1 68415.m00585 glycine-rich protein 35 0.086 At1g70990.1 68414.m08190 proline-rich family protein 35 0.086 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 34 0.11 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 34 0.11 At3g46270.1 68416.m05008 receptor protein kinase-related contain... 34 0.11 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 34 0.11 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 34 0.11 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 34 0.15 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 34 0.15 At4g16240.1 68417.m02464 hypothetical protein 34 0.15 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 34 0.15 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 34 0.15 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 34 0.15 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 34 0.15 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 34 0.15 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 33 0.20 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 33 0.20 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 33 0.20 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 33 0.20 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 33 0.20 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 33 0.20 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 33 0.20 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 33 0.20 At1g59359.1 68414.m06677 40S ribosomal protein S2 (RPS2B) simila... 33 0.20 At1g58983.1 68414.m06666 40S ribosomal protein S2, putative simi... 33 0.20 At1g58684.1 68414.m06657 40S ribosomal protein S2, putative 33 0.20 At1g58380.1 68414.m06642 40S ribosomal protein S2 (RPS2A) simila... 33 0.20 At1g04800.1 68414.m00476 glycine-rich protein 33 0.20 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 33 0.26 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 33 0.26 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 33 0.26 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 33 0.26 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 33 0.26 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 33 0.26 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 33 0.26 At3g51290.1 68416.m05614 proline-rich family protein 33 0.26 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 33 0.26 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 33 0.26 At1g02710.1 68414.m00222 glycine-rich protein 33 0.26 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 28 0.28 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 33 0.35 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 33 0.35 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 33 0.35 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 33 0.35 At1g62240.1 68414.m07021 expressed protein 33 0.35 At1g50300.1 68414.m05639 zinc finger (Ran-binding) family protei... 33 0.35 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 33 0.35 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 32 0.46 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 32 0.46 At5g22790.1 68418.m02664 expressed protein 32 0.61 At4g32340.1 68417.m04603 expressed protein 32 0.61 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 32 0.61 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 32 0.61 At3g29060.1 68416.m03635 EXS family protein / ERD1/XPR1/SYG1 fam... 32 0.61 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 32 0.61 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 32 0.61 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 32 0.61 At1g15840.1 68414.m01901 expressed protein 32 0.61 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 32 0.61 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 31 0.81 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 31 0.81 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 31 0.81 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 31 0.81 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 31 0.81 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 31 0.81 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 31 0.81 At3g51770.1 68416.m05677 tetratricopeptide repeat (TPR)-containi... 31 0.81 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 31 0.81 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 31 0.81 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 31 0.81 At1g77030.1 68414.m08970 glycine-rich protein 31 0.81 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 31 0.81 At1g54060.1 68414.m06160 expressed protein similar to 6b-interac... 31 0.81 At1g28240.1 68414.m03466 expressed protein 31 0.81 At1g07135.1 68414.m00759 glycine-rich protein 31 0.81 At5g61660.1 68418.m07736 glycine-rich protein 31 1.1 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 31 1.1 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 31 1.1 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 31 1.1 At3g43583.1 68416.m04636 hypothetical protein 31 1.1 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 31 1.1 At1g15830.1 68414.m01900 expressed protein 31 1.1 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 31 1.1 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 31 1.4 At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP... 31 1.4 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 31 1.4 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 31 1.4 At5g11550.1 68418.m01347 expressed protein 31 1.4 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 31 1.4 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 31 1.4 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 31 1.4 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 31 1.4 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 31 1.4 At3g05220.2 68416.m00570 heavy-metal-associated domain-containin... 31 1.4 At3g05220.1 68416.m00569 heavy-metal-associated domain-containin... 31 1.4 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 31 1.4 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 31 1.4 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 31 1.4 At1g12380.1 68414.m01431 expressed protein 31 1.4 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 30 1.9 At5g51300.2 68418.m06360 splicing factor-related contains simila... 30 1.9 At5g51300.1 68418.m06359 splicing factor-related contains simila... 30 1.9 At4g32375.1 68417.m04610 glycoside hydrolase family 28 protein /... 30 1.9 At4g21720.1 68417.m03145 expressed protein 30 1.9 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 30 1.9 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 30 1.9 At3g47500.1 68416.m05166 Dof-type zinc finger domain-containing ... 30 1.9 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 30 1.9 At3g08640.1 68416.m01003 alphavirus core protein family contains... 30 1.9 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 30 1.9 At2g44790.1 68415.m05574 uclacyanin II strong similarity to ucla... 30 1.9 At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to S... 30 1.9 At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to S... 30 1.9 At1g04660.1 68414.m00463 glycine-rich protein 30 1.9 At5g65180.2 68418.m08199 expressed protein contains Pfam domain,... 30 2.5 At5g65180.1 68418.m08198 expressed protein contains Pfam domain,... 30 2.5 At5g62440.1 68418.m07837 expressed protein 30 2.5 At5g48290.1 68418.m05964 heavy-metal-associated domain-containin... 30 2.5 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 30 2.5 At4g35230.1 68417.m05007 protein kinase family protein contains ... 30 2.5 At4g17800.1 68417.m02656 DNA-binding protein-related contains Pf... 30 2.5 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 30 2.5 At3g16350.1 68416.m02068 myb family transcription factor ; conta... 30 2.5 At3g08630.1 68416.m01002 expressed protein 30 2.5 At3g07195.1 68416.m00858 proline-rich family protein 30 2.5 At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar... 30 2.5 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 30 2.5 At2g35920.1 68415.m04409 helicase domain-containing protein simi... 30 2.5 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 30 2.5 At1g35880.1 68414.m04457 hypothetical protein 30 2.5 At1g35617.1 68414.m04424 hypothetical protein 30 2.5 At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kin... 30 2.5 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 30 2.5 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 30 2.5 At1g09460.1 68414.m01058 glucan endo-1,3-beta-glucosidase-relate... 30 2.5 At5g28480.1 68418.m03462 hypothetical protein 29 3.2 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 29 3.2 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 29 3.2 At4g20020.2 68417.m02930 expressed protein 29 3.2 At4g20020.1 68417.m02931 expressed protein 29 3.2 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 29 3.2 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 29 3.2 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 29 3.2 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 29 3.2 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 29 3.2 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 29 3.2 At2g12100.1 68415.m01300 Ulp1 protease family protein contains P... 29 3.2 At1g45090.1 68414.m05169 Ulp1 protease family protein similar to... 29 3.2 At1g19960.1 68414.m02501 expressed protein 29 3.2 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 29 3.2 At1g09070.1 68414.m01012 C2 domain-containing protein / src2-lik... 29 3.2 At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) famil... 29 4.3 At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) famil... 29 4.3 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 29 4.3 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 29 4.3 At4g26480.1 68417.m03810 KH domain-containing protein qkI-7, Mus... 29 4.3 At4g17940.1 68417.m02672 expressed protein 29 4.3 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 29 4.3 At3g55950.1 68416.m06217 protein kinase family protein contains ... 29 4.3 At3g55790.1 68416.m06199 expressed protein predicted protein, Ar... 29 4.3 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 29 4.3 At3g07560.1 68416.m00903 glycine-rich protein 29 4.3 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 29 4.3 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 29 4.3 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 29 4.3 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 29 4.3 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 29 4.3 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 29 4.3 At2g30505.1 68415.m03716 Expressed protein 29 4.3 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 29 4.3 At2g05540.1 68415.m00586 glycine-rich protein 29 4.3 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 29 4.3 At1g13830.1 68414.m01623 beta-1,3-glucanase-related similar to b... 29 4.3 At5g49720.1 68418.m06157 endo-1,4-beta-glucanase KORRIGAN (KOR) ... 25 4.9 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 29 5.7 At5g07650.1 68418.m00876 formin homology 2 domain-containing pro... 29 5.7 At5g02600.2 68418.m00195 heavy-metal-associated domain-containin... 29 5.7 At5g02600.1 68418.m00196 heavy-metal-associated domain-containin... 29 5.7 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 29 5.7 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 29 5.7 At4g19200.1 68417.m02833 proline-rich family protein contains pr... 29 5.7 At3g59640.1 68416.m06654 glycine-rich protein 29 5.7 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 29 5.7 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 29 5.7 At2g40950.1 68415.m05056 bZIP transcription factor family protei... 29 5.7 At2g11005.1 68415.m01177 glycine-rich protein 29 5.7 At1g76010.1 68414.m08825 expressed protein 29 5.7 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 29 5.7 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 29 5.7 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 29 5.7 At5g56140.1 68418.m07003 KH domain-containing protein 28 7.5 At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 28 7.5 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 28 7.5 At5g41460.1 68418.m05035 fringe-related protein strong similarit... 28 7.5 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 28 7.5 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 28 7.5 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 28 7.5 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 28 7.5 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 28 7.5 At4g15460.1 68417.m02363 glycine-rich protein 28 7.5 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 28 7.5 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 28 7.5 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 28 7.5 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 28 7.5 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 28 7.5 At3g46740.1 68416.m05074 chloroplast outer envelope protein, put... 28 7.5 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 28 7.5 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 28 7.5 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 28 7.5 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 28 7.5 At1g80130.1 68414.m09379 expressed protein 28 7.5 At1g55900.1 68414.m06411 NLI interacting factor (NIF) family pro... 28 7.5 At1g53640.1 68414.m06100 hypothetical protein ; expression suppo... 28 7.5 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 28 7.5 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 28 7.5 At1g47660.1 68414.m05295 hypothetical protein 28 7.5 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 28 7.5 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 28 7.5 At1g20220.1 68414.m02525 expressed protein 28 7.5 At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing ... 28 9.9 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 28 9.9 At5g24316.1 68418.m02864 proline-rich family protein contains pr... 28 9.9 At4g37900.1 68417.m05360 glycine-rich protein 28 9.9 At4g32640.1 68417.m04646 sec23/sec24 transport protein-related 28 9.9 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 28 9.9 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 28 9.9 At3g54220.1 68416.m05993 scarecrow transcription factor, putativ... 28 9.9 At3g50190.1 68416.m05488 expressed protein contains Pfam profile... 28 9.9 At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) fa... 28 9.9 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 28 9.9 At2g32080.2 68415.m03921 PUR alpha-1 protein identical to PUR al... 28 9.9 At2g32080.1 68415.m03920 PUR alpha-1 protein identical to PUR al... 28 9.9 At2g28180.1 68415.m03422 cation/hydrogen exchanger, putative (CH... 28 9.9 At2g18470.1 68415.m02151 protein kinase family protein contains ... 28 9.9 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 28 9.9 At2g07698.1 68415.m00949 ATP synthase alpha chain, mitochondrial... 28 9.9 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 28 9.9 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 28 9.9 At1g68390.1 68414.m07813 expressed protein contains Pfam profile... 28 9.9 At1g49270.1 68414.m05524 protein kinase family protein contains ... 28 9.9 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 28 9.9 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 28 9.9 At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein ... 28 9.9 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 28 9.9 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 28 9.9 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 47.6 bits (108), Expect = 1e-05 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +1 Query: 736 GXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G P PPP PPPP P PP PPP P PP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 46.8 bits (106), Expect = 2e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP PPPP P PP PPP P PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P PPP PPPP P PP PP P PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P PPP PPPP P PP PPP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P PPP PPPP P PP PPP P P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPP----XXPPPXAPXXPP 834 P P P PPP PPPP P PP PPP P PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX----PPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PPP PPPP P P PPP P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYP 435 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PPP PPP PP PPP PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP--PPPYVYPPPP 438 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP---PRXPXPPXXPPPXAP 822 PP P P P P P PPP PPP P P P PPP +P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP--XXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PP PPPP PP PP P PP Sbjct: 392 PPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PPP PPP P PP PP P P Sbjct: 400 PPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPP--PSPPYVYPPPPPSPQP 453 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P P PPPP P PPP PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPP 436 Score = 34.7 bits (76), Expect = 0.086 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPX----PPXXPPPXAPXXPP 834 PP P P P P P P PP PPPP P PP P P PP Sbjct: 404 PPPPYVYPSPPPPPPS---PPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P + P P P P PP PPPP P P P P P Sbjct: 414 PPPPPSPPPYVYPPPPPPYVYPP---PPSPPYVYPPPPPSPQPYMYPSPPCNDLP 465 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP +PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = -2 Query: 403 PPPPXXPXXXPXGPAXXPPSXXGAPPXF 320 PPPP P P P PP PP + Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPY 408 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P P PS PP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P P PP PPPP+ P PP PPP P P Sbjct: 56 PEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 2/65 (3%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP--PPRXPXPPXXPPPXA 819 GG PP P P P P P PPP PP PP P PP PPP Sbjct: 40 GGNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPP-- 97 Query: 820 PXXPP 834 P PP Sbjct: 98 PQLPP 102 Score = 44.8 bits (101), Expect = 8e-05 Identities = 23/61 (37%), Positives = 24/61 (39%) Frame = +1 Query: 649 GGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXX 828 GGG P P +P P P P P P P PPP P PP PPP P Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSP-PPSPPPPQLPPP 97 Query: 829 P 831 P Sbjct: 98 P 98 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P P P P P PPP PPPP+ P P P +P P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P PPS +PP Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPP 90 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP 795 PP P P P Q P P P PP P PP P Sbjct: 77 PPCPPP-PSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P P P P P P PPP PPP P PP PPP P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PPP PPPP P P PPP +P PP Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPP--PPPVYSPPPPSPPPPP 491 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP--RXPXPPXXPPPXAPXXPP 834 P P + P P P P P PPP PPPP P PP PPP P P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSP 482 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PPP PPPP P PPP P PP Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPX--GXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PPP PPP P PP PPP P P Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSP 497 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P P P P PPP PPP P PP PP +P P Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPP 485 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRX---PXPPXXPPPXAPXXPP 834 PP P P P P P PPP PPPP P PP PPP P P Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSP 512 Score = 42.7 bits (96), Expect = 3e-04 Identities = 24/64 (37%), Positives = 25/64 (39%), Gaps = 8/64 (12%) Frame = +1 Query: 667 PPXPX-ATPGXXXGPXXGQRPXPXGXXPGXPPPXXP-------PPPRXPXPPXXPPPXAP 822 PP P +TP P P P P PPP P PPP P P PPP P Sbjct: 412 PPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPP 471 Query: 823 XXPP 834 PP Sbjct: 472 PPPP 475 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PPP PPPP PP P +P PP Sbjct: 470 PPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PP PPPP P PP PP +P PP Sbjct: 466 PPPPPPPPPP---PPPVYSPPPPSPPPPPPPVYSPPPP--PPPPPPPPVYSPPPPP 516 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PPP PPPP P PP + PP Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPP 524 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP---RXPXPPXXPPPXAPXXPP 834 P P P P P P P PP PPPP P PP PPP P P Sbjct: 408 PSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSP 466 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP----XXPPPXAPXXPP 834 PP P +P P P P P PPP PPP P PP PPP +P P Sbjct: 475 PPPPVYSPPPPSPPPP---PPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXP--GXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P PPP PPPP P PPP PP Sbjct: 545 PPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPP 602 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +1 Query: 652 GGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 G P P TP P P P P PPPP P P PPP P P Sbjct: 389 GRSVSPRPPVVTP--LPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPP 446 Query: 832 P 834 P Sbjct: 447 P 447 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P + P P P P PPP PPP P PP PPP Sbjct: 539 PPPPHSPPPPQFSPPP---PEPY-YYSSPPPPHSSPPPHSPPPPHSPPP 583 Score = 37.5 bits (83), Expect = 0.012 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP---XXPPPPRXPXPP----XXPPPXAPX 825 PP P P P P P PPP PPPP P P PPP P Sbjct: 484 PPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPH 543 Query: 826 XPP 834 PP Sbjct: 544 SPP 546 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/56 (32%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P ++P P P P PPP P P P PPP P P Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEP 618 Score = 35.1 bits (77), Expect = 0.065 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP---XXPPPXAPXXPP 834 P P P P P PPP PP P PP PPP P PP Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPP 460 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/56 (32%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PPPP+ PP P + PP Sbjct: 512 PPPPPVYSSPPPPPSPAPTPVYCTRPP-PPPPHSPPPPQFSPPPPEPYYYSSPPPP 566 Score = 34.7 bits (76), Expect = 0.086 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 6/61 (9%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR------XPXPPXXPPPXAPXX 828 PP P P P RP P PP PPPP P P PPP +P Sbjct: 521 PPPP---PSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPP 577 Query: 829 P 831 P Sbjct: 578 P 578 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP-XPPXXPPPXAPXXPP 834 P P +P P P P P P PPP P P PPP PP Sbjct: 575 PPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPP 630 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P +P P P P P PP PPPP P PPP P Sbjct: 584 PIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPP-PPCIEYSPPPPPP 634 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXG--QRPXPXGXXPGXPPPXX--PPPPRXPXPPXXPPPXAPXXPP 834 PP P TP P P P P P P PPP PP PP PP Sbjct: 524 PPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPP 583 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P P P P P P PP P P P P P PPP P Sbjct: 497 PPPPPPPPPPP--PVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPP 554 Query: 832 P 834 P Sbjct: 555 P 555 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -2 Query: 418 WGPXXPPPPXXPXXXPXGPAXXPP 347 + P PPPP P P P PP Sbjct: 436 YSPPPPPPPPPPVYSPPPPPPPPP 459 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P PP PP Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPP 484 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPP 347 P PPPP P P P+ PP Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPP 490 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P PP PP Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPP 499 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/65 (43%), Positives = 28/65 (43%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP 654 GG G G G G G RGGG G G PG P G G P GP PG G GG Sbjct: 4 GGCGGGPGRGGRG-FGGRGGGPGFGPGGPGFGPGGPGFGP-GGPGFGPG-GPGFGGRGPR 60 Query: 653 PPPXG 639 P G Sbjct: 61 GPGFG 65 Score = 36.3 bits (80), Expect = 0.028 Identities = 28/78 (35%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = +1 Query: 304 KXSGXGXG-GGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRS 480 + G G G GGP GG G P G GG G G R P P P P Sbjct: 20 RGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRGPRGP---GFGPRGP-GPWSGP 75 Query: 481 RXXXXGGGXGXGXGXGXG 534 R GGG G G G G Sbjct: 76 RGPRPGGGGGPGPGPWSG 93 Score = 31.9 bits (69), Expect = 0.61 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG--XPGXXPXGXGRWPXXGPXLXPGVAXGXGGXX 660 G G G G G GG G G G PG P G G W GP G G GG Sbjct: 32 GFGPGGPGFGPGGPGFGPGGPGFGGRGPRGPGFGPRGPGPW--SGPR---GPRPGGGGGP 86 Query: 659 XPPPPXG 639 P P G Sbjct: 87 GPGPWSG 93 Score = 31.9 bits (69), Expect = 0.61 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 5/61 (8%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXP----XGXGRWPXXGPXLXP-GVAXGXG 669 GG GG GG G RG G G P P G G P GP P G G G Sbjct: 43 GGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGG 102 Query: 668 G 666 G Sbjct: 103 G 103 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 4/69 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXG-GXGXRGGGGXXGGGXPGXXPXG---XGRWPXXGPXLXPGVAXGXGG 666 GG G G G G G G G G G G PG P G GR P GP P G Sbjct: 18 GGRGGGPGFGPGGPGFGPGGPG--FGPGGPGFGPGGPGFGGRGP-RGPGFGPRGPGPWSG 74 Query: 665 XXXPPPPXG 639 P P G Sbjct: 75 PRGPRPGGG 83 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 457 GXGGRTGXXGXXFWGPXXPPPPXXPXXXPXGPAXXPPSXXGAPPXFXXRXVLXGXGGGXG 278 G GG G G GP P P P GP G P R G GGG G Sbjct: 48 GPGG-PGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGGGGPG 106 Query: 277 XG 272 G Sbjct: 107 SG 108 Score = 29.9 bits (64), Expect = 2.5 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 9/63 (14%) Frame = -1 Query: 830 GXXGAXGGGXXG-GXGXRGGGGXXG--------GGXPGXXPXGXGRWPXXGPXLXPGVAX 678 G G G G G G G RG G G GG PG P R P G PG Sbjct: 50 GGPGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGGGGPGSGC 109 Query: 677 GXG 669 G G Sbjct: 110 GSG 112 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PPP PP P P P PPP PP Sbjct: 35 PPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPP 90 Score = 41.9 bits (94), Expect = 6e-04 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXP---XGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P + P GP P P P P P PP P P PPP P PP Sbjct: 15 PPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPP 73 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/56 (35%), Positives = 22/56 (39%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P +P P P PP P P P P PPP AP P Sbjct: 43 PPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPP-APKPVP 97 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P P +P P P PP P P P PP P P P P Sbjct: 40 PKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAP 93 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPX-APXXPP 834 PP P P P P P P PP P P P PP PPP AP P Sbjct: 72 PPKPQPKPAPPPEPKPAPPPAPK-PVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTP 127 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P P P P PPP P P P P P PP Sbjct: 30 PCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQP-KPAPPP 83 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/57 (33%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXG-PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P +P P P P P PP P+ P P P AP P Sbjct: 55 PPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKP 111 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXX-GQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PP PPP P P P P PP Sbjct: 82 PPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR---XPXPPXXPPPXAPXXPP 834 P A PG P +P P P P PPP+ P PP PP P P Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQP 77 Score = 35.5 bits (78), Expect = 0.049 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPX-PXGXXP-GXPPPX-XPPPPRXPXP-PXXPPPXAPXXPP 834 PP P +P P +P P G P PPP P PP P P P PP P P Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKP 62 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P P P P PP P PP P P P P P P Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAP 107 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPX--PPXXPPPXAPXXPP 834 PP P P P P P PPP P P P PP P P PP Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPP 82 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP-XXPPPXAPXXPP 834 P P A P P P P P P P P P PP P P P PP Sbjct: 62 PVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPP 118 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P +P P P P P P P PP P P P Sbjct: 77 PKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSP 131 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P P P P P PP P P P P P P P P Sbjct: 52 PSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPP 105 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP-PPXAPXXPP 834 P P P P P P P P P PP+ P P P PP P P Sbjct: 66 PACPPTPPKPQPKPAPPPEPKP-APPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKP 121 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P P P P PP P P P AP P Sbjct: 79 PAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKP 133 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P P +P P P P P P P P P P P Sbjct: 93 PKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIP 146 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPP-----PXXPPPPRXPXPPXXPPPXAPXXP 831 PP P P P P P P PP P PPP + P PP PPP P P Sbjct: 1070 PPLPPLPPS----PPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPP 1125 Query: 832 P 834 P Sbjct: 1126 P 1126 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/64 (35%), Positives = 25/64 (39%), Gaps = 8/64 (12%) Frame = +1 Query: 667 PPXPXAT----PGXXXGPXXGQRPXPXGXXPGXPP----PXXPPPPRXPXPPXXPPPXAP 822 PP P + P P P P P PP P PPPP P PP PP +P Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSP 1121 Query: 823 XXPP 834 PP Sbjct: 1122 PPPP 1125 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PPP PPP PP PPP P PP Sbjct: 1076 PPSPPP-PSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPP--PPPPP 1128 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAP 329 P PPPP P P P PP P Sbjct: 1101 PPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP-XXPPPPRXPXPPXXPPPXAPXXP 831 PP P P P P P PPP PPPP PP PPP A P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Frame = +1 Query: 670 PXPXATPGXXXGPXX-GQRPXPXGXXP---GXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P ATP P P P P PPP PPP P PP PPP A PP Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP-PPATPPPVASPPPP 96 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP-RXPXPPXXPPPXAPXXP 831 PP + P P P P P PP PPP P PP PP A P Sbjct: 52 PPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P ++P P P PPP PPP P P PPP PP Sbjct: 70 PPPPVSSP-----PPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPP 120 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 715 GQRPX-PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 GQ P P P P P PPP P P PPP PP Sbjct: 20 GQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPP 60 Score = 36.3 bits (80), Expect = 0.028 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 10/72 (13%) Frame = +1 Query: 649 GGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXP----------GXPPPXXPPPPRXPXPP 798 G PP P P P P P PPP PPPP PP Sbjct: 20 GQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPP 79 Query: 799 XXPPPXAPXXPP 834 PPP P PP Sbjct: 80 ASPPPATP--PP 89 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-XPXPPXXPPPXAPXXPP 834 P P + P P P P PPP PPP PP P AP P Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKP 132 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/55 (29%), Positives = 19/55 (34%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P A+P P P P P P PP + P P P +P P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPP--PAPLASPPAQVPAPAPTTKPDSPSPSP 139 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P A+P P P P PP P P P P P PP Sbjct: 93 PPPPVASPPPATPPPVATPP----PAPLASPPAQVPAPAPTTKPDSPSPSPSSSPP 144 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP-XXPPPPRXPXPPXXPPPXAPXXP 831 PP P P P P P PPP PPPP PP PPP A P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Frame = +1 Query: 670 PXPXATPGXXXGPXX-GQRPXPXGXXP---GXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P ATP P P P P PPP PPP P PP PPP A PP Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP-PPATPPPVASPPPP 96 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP-RXPXPPXXPPPXAPXXP 831 PP + P P P P P PP PPP P PP PP A P Sbjct: 52 PPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P ++P P P PPP PPP P P PPP PP Sbjct: 70 PPPPVSSP-----PPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPP 120 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 715 GQRPX-PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 GQ P P P P P PPP P P PPP PP Sbjct: 20 GQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPP 60 Score = 36.3 bits (80), Expect = 0.028 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 10/72 (13%) Frame = +1 Query: 649 GGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXP----------GXPPPXXPPPPRXPXPP 798 G PP P P P P P PPP PPPP PP Sbjct: 20 GQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPP 79 Query: 799 XXPPPXAPXXPP 834 PPP P PP Sbjct: 80 ASPPPATP--PP 89 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-XPXPPXXPPPXAPXXPP 834 P P + P P P P PPP PPP PP P AP P Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKP 132 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/55 (29%), Positives = 19/55 (34%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P A+P P P P P P PP + P P P +P P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPP--PAPLASPPAQVPAPAPTTKPDSPSPSP 139 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P A+P P P P PP P P P P P PP Sbjct: 93 PPPPVASPPPATPPPVATPP----PAPLASPPAQVPAPAPTTKPDSPSPSPSSSPP 144 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP--PXXPPPXAPXXPP 834 P P TP P P P P PPP PPP P P P PPP P PP Sbjct: 121 PPPPPTPYTPPPPTPYTPPPPTVKPP--PPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P P PPPP PP P P AP PP Sbjct: 114 PPPPTVKPPPPPTPYTPPPPTPYTPPP--PTVKPPPPPVVTPPPPTPTPEAPCPPP 167 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P P P + P P P PP PPPP P P P P P P Sbjct: 90 PPPPYVKPPP---PPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/61 (36%), Positives = 24/61 (39%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP---RXPXPP--XXPPPXAPXXP 831 P P P P + P P P PP PPPP + P PP PPP P P Sbjct: 71 PYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTP 130 Query: 832 P 834 P Sbjct: 131 P 131 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PP PPPP PP PPP PP Sbjct: 63 PPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPP--PPPYVKPPPP 116 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P P P PPPP PP PP P PP Sbjct: 98 PPPPTVKPPPP--PYVKPPPPPTVKPPPPPTPYTPPPPTPYTPP--PPTVKPPPPP 149 Score = 37.1 bits (82), Expect = 0.016 Identities = 21/62 (33%), Positives = 23/62 (37%), Gaps = 6/62 (9%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP----RXPXP--PXXPPPXAPXX 828 PP P P +P P PPP PPP + P P P PPP P Sbjct: 78 PPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYT 137 Query: 829 PP 834 PP Sbjct: 138 PP 139 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP--RXPXPPXXPPPXAPXXPP 834 PP P P P P PPP P PP + P PP PP P P Sbjct: 48 PPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKP 105 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P P PPPP P PP PP P P Sbjct: 42 PKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKP 97 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXX----PPPXAPXXPP 834 P P P P P P PP PPPP P PP PP P PP Sbjct: 36 PHPVKPPKHPAKPPKPPTVKPPTHTP-KPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPP 93 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P P P P P P PPPP P PP P P Sbjct: 132 PPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPT-PYPPPPKPETCP 182 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P TP P P P P P P P P P PPP P Sbjct: 130 PPPP--TPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWP 714 GG G GGG GG G GGGG GGG G G G P Sbjct: 589 GGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGGEP 628 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 G G GGG GG G GGGG GGG G Sbjct: 585 GGYGGGGGGYGGGGGYGGGGGYGGGGGYG 613 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G+ GG GG G GGGG GGG Sbjct: 578 GSFGSGRGGYGGGGGGYGGGGGYGGG 603 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GGG G GG G GGGG G Sbjct: 588 GGGGGGYGGGGG--YGGGGGYGGGGGYGG 614 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 G GG GG G GGGG GGG G Sbjct: 578 GSFGSGRGGYGGGGGGYGGGGGYGGGGGYG 607 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G GGG G GG G GGGG G Sbjct: 581 GSGRGGYGGGGGG-YGGGGGYGGGGGYGG 608 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G G GG G Sbjct: 586 GYGGGGGGYGGGGGYGG-GGGYGGGGGYGGGYG 617 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 314 GXEXGGGPXGXGG-GXGXTXGGXXGXXGGGGXXGXP 418 G GGG G GG G G GG G GG G P Sbjct: 593 GYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGGEP 628 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +2 Query: 329 GGPXGXGGGXGXTXG-GXXGXXGGGGXXG 412 GG G GGG G G G G GGGG G Sbjct: 585 GGYGGGGGGYGGGGGYGGGGGYGGGGGYG 613 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G+ G G GG G GGG GGG G G G Sbjct: 578 GSFGSGR-GGYGGGGGGYGGGGGYGGGGGYGGG 609 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P PPP PPP + PP PP P PP Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXX---PPPPRXPXPPXXPPPXAPXXPP 834 P +P P P PPP PPPP P P P +P PP Sbjct: 43 PCLQNQPPPP---PSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPP 85 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP 795 PP P + P P P PP PPPP P P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPP-PRXPXPPXXPPPXAPXXPP 834 Q P P P P PPP P P PP P PP Sbjct: 48 QPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPP 87 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 41.9 bits (94), Expect = 6e-04 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG G GGGG GGG G G G G G A G GG Sbjct: 200 GGSHGGAGGYGGGGGGGSGGGGAYGGG--GAHGGGYGSGGGEGGGYGGGAAGGYGG 253 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GA GGG GG G GGGG GGG G G G G G G GG Sbjct: 192 GEGGGAGGGGSHGGAGGYGGGG--GGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGG 245 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG G GGG GG G GGGG GGG G G Sbjct: 237 GGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGG 271 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG GG G GGGG GGG G G G G GG Sbjct: 207 GGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGG 261 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGG-GGXXGGGXPGXXPXGXG 723 GG G GGG GG G G GG GGG G G G Sbjct: 245 GGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGG 282 Score = 34.7 bits (76), Expect = 0.086 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG GG G GG GGG G G G G G GG Sbjct: 35 GGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGG 89 Score = 34.7 bits (76), Expect = 0.086 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GA GGG GG G GGGG GG G G G G G A G GG Sbjct: 159 GYGGGAYGGG--GGHGG-GGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGG 211 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG G G GG GGG G G G G G GG Sbjct: 166 GGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGG 221 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G G G GGG G Sbjct: 31 GQASGGGGHGGGGGSGGVSSGGYGGESGGGYGG 63 Score = 33.1 bits (72), Expect = 0.26 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 6/61 (9%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXG------GGXPGXXPXGXGRWPXXGPXLXPGVAXGX 672 GG G GGG GG G GGG G GG G G G G G G Sbjct: 51 GGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGG 110 Query: 671 G 669 G Sbjct: 111 G 111 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG G G G GGG G G G G A G GG Sbjct: 84 GSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGG 139 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 305 NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 N AG G G G GGG GG G GGG G Sbjct: 147 NGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGG 182 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG G GGG G G G G G G A G GG Sbjct: 173 GGGGGGSAGGAHGGSGY-GGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227 Score = 33.1 bits (72), Expect = 0.26 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG-XGRWPXXGPXLXPGVAXGXGGXXX 657 GG G+ GGG GG G GG GGG G G G G G G GG Sbjct: 230 GGGYGS-GGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGGY 288 Query: 656 PP 651 P Sbjct: 289 AP 290 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGX---GXTXGGXXGXXGGGGXXG 412 AG GGG G GGG G GG G GGGG G Sbjct: 248 AGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHG 284 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGG-GPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G E GG G G GG G GG G GGGG G Sbjct: 191 GGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYG 224 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 305 NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 N GGG G GG G + GG G GGG G Sbjct: 29 NYGQASGGGGHGGGGGSGGVSSGGYGGESGGGYGGG 64 Score = 32.3 bits (70), Expect = 0.46 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG G GG G G G G G G G G GG Sbjct: 162 GGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGG--AGGYGGGGGG 215 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G + GG G G GG G Sbjct: 162 GGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEG 194 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G G G GGG G Sbjct: 163 GAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGG 195 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GG G G G G + GG G GGGG Sbjct: 185 GGSGYGGGEGGGAGGGGSHGGAGGYGGGGG 214 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGG--GGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG GG GG GG GGG G G G G G GG Sbjct: 218 GGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGG 275 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GG G GG G GGGG G Sbjct: 226 GGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGG 258 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 +G G G GGG G GG G GGG G Sbjct: 97 SGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGG 130 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 G GA GG GG G GG G G G G G G A G G Sbjct: 178 GSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGG 232 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 314 GXEXGGGPXG--XGGGXGXTXGGXXGXXGGG 400 G E GGG G GGG G GG G GGG Sbjct: 257 GGEGGGGSYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 G GGG G G GGG G G G G G G G G G Sbjct: 103 GAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAG 156 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GA GG G G GG GGG G G G G G GG Sbjct: 144 GYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGG 199 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG G G GGG GG G G G G GG Sbjct: 63 GGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGG 118 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG G GGG G GG G GGGG G Sbjct: 204 GGAGGYGGGGGGGSGG-GGAYGGGGAHG 230 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG G G GG GG G G G + G G GG Sbjct: 74 GGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGG 129 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGG 403 GG G GG G GG G GGGG Sbjct: 107 GGGGGYGGAAGGHAGGGGGGSGGGG 131 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 314 GXEXGGGPXGX--GGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GGGG G Sbjct: 232 GYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYG 266 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G GG G GGGG G Sbjct: 172 GGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHG 204 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXG-GGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G G GG GG GG GG G G G G G G GG Sbjct: 181 GGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGG 237 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGG-XXGXXGGGGXXG 412 AG GGG G GGG GG G G GG G Sbjct: 206 AGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEG 240 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 314 GXEXGGGPXGXGG--GXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G G GG G GGG G Sbjct: 215 GGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAG 249 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G G G GG G GG G GGGG Sbjct: 63 GGSGEGAGGGYGGAEGYASGGGSGHGGGGG 92 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGG--XXGXXGGGGXXG 412 GGG G GGG G GG G GG G G Sbjct: 161 GGGAYGGGGGHGGGGGGGSAGGAHGGSGYGG 191 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G G GG G GG G Sbjct: 221 GAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGG 253 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 818 AXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 A G G GG G G G GG G G G G G G G Sbjct: 101 ASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAG 150 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXG--GGG 403 G G G G GGG G GG G G GGG Sbjct: 201 GSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGG 232 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 E GGG G G G GG G GGGG Sbjct: 106 EGGGGGYGGAAG-GHAGGGGGGSGGGGG 132 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 314 GXEXGG--GPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G G GGG G GG G GG G Sbjct: 177 GGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGG 211 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +2 Query: 326 GGGPXGXGG--GXGXTXGGXXGXXGG-GGXXG 412 GGG G GG G G GG G GG GG G Sbjct: 213 GGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYG 244 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXG--GGGXXG 412 G GG G GGG G GG G GGG G Sbjct: 241 GGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGG 275 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 41.5 bits (93), Expect = 8e-04 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PPP PPPP P P PPP P PP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPP 85 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPP 813 P PPP PPPP P PP PPP Sbjct: 61 PPSPPPPSPPPPACPPPPALPPP 83 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P PPP PPPP P PP P + PP Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPP--PKKVSSYCPP 94 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 685 TPGXXXGPXXGQRPXPXGXXPGXPPP--XXPPPPRXPXPPXXPPPXA 819 +P P P P P PPP PPPP+ PPP A Sbjct: 52 SPSCIQNPPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPPA 98 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 403 PPPPXXPXXXPXGPAXXPPSXXGAPP 326 PPPP P P PA PP PP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPP 84 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PP PPP + P PP PPP AP PP Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPPP 394 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P P Q P PPP PPP P PP PPP P Sbjct: 347 PPPP---PNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAP 822 P PPP PPPP P PP PPP P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 Q P P PPP PPPP P PP PPP Sbjct: 33 QDPPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +1 Query: 754 PP--PXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P PPPP P PP PPP P PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPP 63 Score = 38.7 bits (86), Expect = 0.005 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXA 819 PPP PPPP P PP PPP A Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPA 65 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPPP P PP PPP P PP Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 35.9 bits (79), Expect = 0.037 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P PPPP P PP PPP P P Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P Q P P P PPP PPPP P PP PP Sbjct: 36 PLFPQSPPPPPPPP--PPPPPPPPPPPPPPPAVNMSVETGIPP 76 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P PPP PPPP P P PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P G P P PP PPPR PP P P P Sbjct: 61 PPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHP 116 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA--PXXPP 834 PP P P P G P PP P PP PPP + P PP Sbjct: 50 PPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPP 107 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/55 (29%), Positives = 18/55 (32%) Frame = -1 Query: 536 PPXPWPXPXPXPPPXXXXRDLSRGVXGXGGAXRXSGGXLLGXPXAPPPPXXPXXP 372 PP P P P P PPP + G+ L P PPP P Sbjct: 50 PPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPP 104 Score = 30.7 bits (66), Expect = 1.4 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 13/65 (20%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPX---GXXPGXPPPXXP----------PPPRXPXPPXXP 807 PP P P P P P G PPP P PPP P P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQP 102 Query: 808 PPXAP 822 PP P Sbjct: 103 PPKPP 107 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/52 (28%), Positives = 20/52 (38%) Frame = -1 Query: 536 PPXPWPXPXPXPPPXXXXRDLSRGVXGXGGAXRXSGGXLLGXPXAPPPPXXP 381 PP P P P P PPP ++ V ++ +PPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPP 97 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P PA G PP Sbjct: 48 PPPPPPPPPPPPPPPPPAVNMSVETGIPP 76 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 6/43 (13%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPP---RXPXPPXXPPP---XAPXXPP 834 P G P PPP PPPP R P PP PPP AP PP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPP 57 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR--XPXPPXXPPP 813 PP P P P P P PPP P R P PP PPP Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPP 76 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 40.7 bits (91), Expect = 0.001 Identities = 30/76 (39%), Positives = 30/76 (39%), Gaps = 7/76 (9%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGG-GGXXGGGXP-GXXPXGXGRWP--XXGPXLXPGVAXGXGG 666 GG G GGG GG G GG GG GGG P G G G P PG A G Sbjct: 107 GGRFGKPGGGGLGGGGLPGGLGGLGGGGLPGGLGGLGGGENPLAKISKMFGPGAAGAASG 166 Query: 665 XXXP---PPPXGAXXA 627 P P GA A Sbjct: 167 DAPPAETAPAAGAAPA 182 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/60 (36%), Positives = 23/60 (38%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP 654 GG GG GG + GGG GG G P G G G PG G GG P Sbjct: 95 GGLRRFGGGRRFGGRFGKPGGGGLGG---GGLPGGLGGLGGGG---LPGGLGGLGGGENP 148 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPX---GXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P + P P P PPP PPP P P PPP PP Sbjct: 57 PPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXX-GQRPXPXGXXPGXPPPXXPP--PPRXPXPPXXPPPXA 819 PP P P P P P P PPP PP PP P PP PPP A Sbjct: 64 PPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPPA 117 Score = 37.1 bits (82), Expect = 0.016 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 7/72 (9%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXX------PGXPPPXXPPPPRXP-XPP 798 P G G PP P P P P P P PP P PPR PP Sbjct: 20 PPGTTGTCCPP-PLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPP 78 Query: 799 XXPPPXAPXXPP 834 PPP P PP Sbjct: 79 LFPPPPLPRLPP 90 Score = 36.3 bits (80), Expect = 0.028 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGX--PPPXXPPPP--RXPXPPXXPPPXAPXXPP 834 PP ++P P P P PPP PPPP R P PP PPP P P Sbjct: 45 PPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLP-PPLLPPPEEPPREP 103 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP---XAPXXPP 834 PP P P P P P G PPP PP + PP PPP AP PP Sbjct: 523 PPPPPPPPRAAVAPPPP--PPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPP 579 Score = 36.7 bits (81), Expect = 0.021 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP---RXPXPPXXP 807 PP P PG P P P G PPP PPPP R P PP P Sbjct: 536 PPPPPPPPGTAAAPPPP--PPPPGTQAAPPPP--PPPPMQNRAPSPPPMP 581 Score = 35.5 bits (78), Expect = 0.049 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-PRXPXPPXXPPPX 816 P G PP P P P P G PPP P P PP PPP Sbjct: 553 PPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPPM 612 Query: 817 A 819 A Sbjct: 613 A 613 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXA-TPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P A P P P PPP PP PP PPP PP Sbjct: 494 PPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPP 550 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +1 Query: 652 GGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 G PP P P P P P PPP P PP P A P Sbjct: 505 GSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPP 564 Query: 832 P 834 P Sbjct: 565 P 565 Score = 33.5 bits (73), Expect = 0.20 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 6/62 (9%) Frame = +1 Query: 667 PPXPXAT-PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP-----XPPXXPPPXAPXX 828 PP P A P P P PPP PPPP P PP PPP A Sbjct: 478 PPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPP--PPPPPLPTTIAAPPPPPPPPRAAVA 535 Query: 829 PP 834 PP Sbjct: 536 PP 537 Score = 32.7 bits (71), Expect = 0.35 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P PPP PPP P PPP P P Sbjct: 454 PPPPPPPPPPPAVMPLKHFAPPPPPPLPP 482 Score = 32.7 bits (71), Expect = 0.35 Identities = 21/72 (29%), Positives = 21/72 (29%), Gaps = 7/72 (9%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPP-------PXXPPPPRXPXPP 798 P G PP P PG P P P PP PPPP P P Sbjct: 540 PPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPL 599 Query: 799 XXPPPXAPXXPP 834 P PP Sbjct: 600 ANGATPPPPPPP 611 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P G P P P G PP PPP PPP P Sbjct: 578 PPMPMGNSGSGGPPPP---PPPMPLANGATPPPPPPPMAMANGAAGPPPPPP 626 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 P G G PP P G P P G P PPP PP Sbjct: 581 PMGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPPP 640 Query: 820 P 822 P Sbjct: 641 P 641 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 5/57 (8%) Frame = -1 Query: 536 PPXPWPXPXPXPPPXXXXR-----DLSRGVXGXGGAXRXSGGXLLGXPXAPPPPXXP 381 PP P P PPP R + G G GG L PPPP P Sbjct: 555 PPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP PPP P P P PP Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLPSPPPTPP 445 Score = 24.6 bits (51), Expect(2) = 2.8 Identities = 12/40 (30%), Positives = 14/40 (35%) Frame = +2 Query: 170 PXXXXXPXXXPXXXPXPXQXXXXXXRGLKXNXGPPXPPPP 289 P P P P + LK + PP PPPP Sbjct: 476 PPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPP 515 Score = 23.4 bits (48), Expect(2) = 2.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 269 PPXPPPPP 292 PP PPPPP Sbjct: 549 PPPPPPPP 556 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/56 (42%), Positives = 25/56 (44%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G RG GG GGG G G G G + G G GG Sbjct: 449 GGAVGGGGGGSVGGGG-RGSGGA-GGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGG 502 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/56 (42%), Positives = 25/56 (44%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G RG GG GG G G G G + GV G GG Sbjct: 299 GGAVGGGGGGSVGGGG-RGSGGA-SGGASGGASGGAGGSVGAGGGVGGGVGGGVGG 352 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG GA GG G G GGGG GGG G G G G GV G G Sbjct: 438 GGVGGAVGGAVGGAVGG-GGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGG 491 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G+ G G GG G GG GG G G GR G GV G G Sbjct: 71 GGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVG 125 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G GG GG G G G G + GV GG Sbjct: 237 GGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGG 292 Score = 36.7 bits (81), Expect = 0.021 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G+ GGG G G GG GGG G G G G GV G GG Sbjct: 192 GGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSG-----GASGGVGVGGGAGG 242 Score = 36.7 bits (81), Expect = 0.021 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GA GGG G G RG GG GG G G G G G GG Sbjct: 209 GSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGG 263 Score = 36.7 bits (81), Expect = 0.021 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GA GG GG G G G GG G G G G GV G GG Sbjct: 510 GGVRGAVGGAVGGGVG---GAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGG 562 Score = 35.9 bits (79), Expect = 0.037 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 5/60 (8%) Frame = -1 Query: 833 GGXXGAXGG-----GXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG GA GG G GG G GG GG G G GR G GV G G Sbjct: 121 GGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVG 180 Score = 35.5 bits (78), Expect = 0.049 Identities = 21/56 (37%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXX-GGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GGG GG G GGGG G G G G G G + G + G GG Sbjct: 48 GVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGG 103 Score = 35.5 bits (78), Expect = 0.049 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG GGG G G G G G G G + G GG Sbjct: 83 GGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGG 138 Score = 35.5 bits (78), Expect = 0.049 Identities = 23/56 (41%), Positives = 25/56 (44%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG G G +GGGG GGG G G G G G+ G GG Sbjct: 95 GGASGGAGGGGK-GRGRKGGGG-AGGGVGGGVGAGGGAGGSVG--AGGGIGGGAGG 146 Score = 35.5 bits (78), Expect = 0.049 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G RG GG GG G G G G A G GG Sbjct: 367 GGAVGGGGGGSVGGGG-RGSGGA-SGGASGGASGGASGGASGGASGGVGGAGGAGG 420 Score = 35.1 bits (77), Expect = 0.065 Identities = 20/56 (35%), Positives = 22/56 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G G G G GGG GGG G G G G + G + G GG Sbjct: 103 GGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGG 158 Score = 35.1 bits (77), Expect = 0.065 Identities = 22/62 (35%), Positives = 24/62 (38%), Gaps = 6/62 (9%) Frame = -1 Query: 833 GGXXGAXGGGXXG------GXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGX 672 GG G GG G G G +G GG GGG G G G G + G G Sbjct: 138 GGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGS 197 Query: 671 GG 666 GG Sbjct: 198 GG 199 Score = 35.1 bits (77), Expect = 0.065 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = -1 Query: 833 GGXXGAXGG--GXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GG G GG G GGGG GGG G G G G G A G G Sbjct: 468 GGAGGGTGGSVGAGGGVGV-GGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGG 523 Score = 35.1 bits (77), Expect = 0.065 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G G G G G G GG GGG G G G G G A G G Sbjct: 521 GGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVG--VGAGGSTGGGAAGGGG 573 Score = 34.7 bits (76), Expect = 0.086 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Frame = -1 Query: 830 GXXGAXGG-GXXGGXGXRGGGGXXGGGXPG---XXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GA GG G GG G GGG GGG G G G L GV G GG Sbjct: 226 GSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGG 284 Score = 34.7 bits (76), Expect = 0.086 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGX-RGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GA GG GG G GGGG GG G G GV G GG Sbjct: 292 GAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGG 348 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG G G G GG G G G G + GV G GG Sbjct: 305 GGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGG 360 Score = 34.7 bits (76), Expect = 0.086 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGX-RGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GA GG GG G GGGG GG G G G G+ G GG Sbjct: 442 GAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGG 498 Score = 34.3 bits (75), Expect = 0.11 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGG--GGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GG GG RGG GG GGG G G G G G+ G GG Sbjct: 146 GAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVG--AGGGIGSGGGG 201 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GA GG G G GG G G G G G + GV G GG Sbjct: 387 GASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGG 442 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/76 (30%), Positives = 26/76 (34%) Frame = +1 Query: 310 SGXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRXX 489 +G G GG GG G G G G GG G + + R R Sbjct: 53 AGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKG 112 Query: 490 XXGGGXGXGXGXGXGG 537 G G G G G G GG Sbjct: 113 GGGAGGGVGGGVGAGG 128 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 AG GGG G GG G GG G GGG G Sbjct: 144 AGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGG 177 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G G GG GG G G G G G + G G Sbjct: 340 GGVGGGVGGGVGGGVGG-GVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASG 394 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G GG GGG G G G G G GG Sbjct: 481 GGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGG---VGGAGRGSGG 533 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 G G GGG GG G G GG GGG G G Sbjct: 62 GVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGG 96 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G G G G G GGGG G G G G G G + G GG Sbjct: 198 GGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGG 252 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GA GG G G GGGG GGG G G G + G G Sbjct: 356 GGVGGAVGGAVGGAVGG-GGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASG 410 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG GGGG GGG G G G G + G GG Sbjct: 287 GGSVGGAVGGAVGGAVGGGGGGSVGGG--GRGSGGASGGASGGASGGAGGSVGAGG 340 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GA GG G G GG GG G G G G + GV GG Sbjct: 391 GASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGG 446 Score = 32.7 bits (71), Expect = 0.35 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = -1 Query: 833 GGXXGAXG---GGXXGGXGXRGG-GGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GA G GG GG G GG GG GG G G G G G GG Sbjct: 217 GGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGG 276 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG G G GG G G G G G + GV G GG Sbjct: 455 GGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGG 510 Score = 32.3 bits (70), Expect = 0.46 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG GG G GG G G G G G G G A G GG Sbjct: 165 GKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGG--RGSGGASGGGG 218 Score = 32.3 bits (70), Expect = 0.46 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 5/60 (8%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGG--GGXXG---GGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G+ GGG G G GG GG G GG G G G G + G G G Sbjct: 372 GGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGG 431 Score = 32.3 bits (70), Expect = 0.46 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGG-GG--XXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG G GG GG GGG G G G G A G GG Sbjct: 398 GGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGG 456 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG G GGG G GG G GGG G Sbjct: 475 GGSVGAGGGVGVGGGGGIGGGAGGGVGG 502 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG G G GG GGG G G G + G G GG Sbjct: 80 GAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGV--GAGGGAGG 132 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 AG GGG G GG G G G GGG G Sbjct: 89 AGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGG 122 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG G G GG GGG G G G + G G GG Sbjct: 135 GAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGV--GAGGGAGG 187 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GG G Sbjct: 375 GGSVGGGGRGSGGASGGASGGASGGASGGASGG 407 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 311 AGXEXGGGPXGX-GGGXGXTXGGXXGXXGGGGXXG 412 AG GGG G GGG G GG G GGG G Sbjct: 424 AGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGG 458 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GGG G GG G GGG G Sbjct: 55 GGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGG 87 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G GG GG G G G G G + G G Sbjct: 272 GGLGGGVGGGVGGGVGG-SVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASG 326 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG G G GG GGG G G G G + G GG Sbjct: 280 GGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASG-GASGGASGGAGG 334 Score = 31.5 bits (68), Expect = 0.81 Identities = 21/57 (36%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXG-GGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G+ G GG GG GGG GGG G G G + GV GG Sbjct: 462 GGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGG 518 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG G GGG G G G GG GGG G G R Sbjct: 542 GGAGGGVGGGANVGVGV-GAGGSTGGGAAGGGGVGNRR 578 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG G GGG G GG G GGG G Sbjct: 333 GGSVGAGGGVGGGVGGGVGGGVGGGVGG 360 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GGG G GG G GGG G Sbjct: 344 GGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGG 376 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GA GG G G GG G G G G + GV G GG Sbjct: 384 GSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGG 438 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GA GG G G GG G GG G G G + V GG Sbjct: 395 GASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGG 450 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +2 Query: 326 GGGPXGXGG-GXGXTXGGXXGXXGGGGXXG 412 GGG G GG G G GG G G GG G Sbjct: 456 GGGSVGGGGRGSGGAGGGTGGSVGAGGGVG 485 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 5/38 (13%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXG-----GXXGXXGGGGXXG 412 G GGG G GG G T G G G GGGG G Sbjct: 457 GGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGG 494 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 311 AGXEXG-GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 AG G GG G GGG G GG G GGG G Sbjct: 480 AGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRG 514 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXGXPK 421 G G G G GGG G GG G GG G K Sbjct: 71 GGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGK 106 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXGXPK 421 GG G GGG G GG G GG G K Sbjct: 131 GGSVGAGGGIGGGAGGAIGGGASGGVGGGGK 161 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GG G Sbjct: 307 GGSVGGGGRGSGGASGGASGGASGGAGGSVGAG 339 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G G GG G GG G Sbjct: 517 GGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVG 549 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G + GGG G GG GG G G GG G Sbjct: 109 GRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIG 141 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 AG GGG G GGG G + G G GG G Sbjct: 116 AGGGVGGG-VGAGGGAGGSVGAGGGIGGGAG 145 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GGG G GG G G GG G Sbjct: 165 GKSGGGAGGGVGGGVG-AGGGAGGSVGAGGGIG 196 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 AG GGG G GGG G + G G GGG Sbjct: 171 AGGGVGGG-VGAGGGAGGSVGAGGGIGSGGG 200 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGA-XGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG G G RG GG GGG G G G G A G GG Sbjct: 190 GAGGGIGSGGGGTVGAGGRGSGGASGGGGT-VGAGGRGSGGASGGVGVGGGAGGSGG 245 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGG---GGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG G G G GG GGG G G G G + G G Sbjct: 114 GGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAG 172 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G GG G GGG G Sbjct: 123 GVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGG 155 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 AG G G GG G GG G GGGG Sbjct: 130 AGGSVGAGGGIGGGAGGAIGGGASGGVGGGG 160 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 311 AGXEXGGGPXGX-GGGXGXTXGGXXGXXGGGGXXG 412 AG GGG G GGG G + GG G GG G Sbjct: 270 AGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGG 304 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GG G GG G GGG G Sbjct: 348 GGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGG 380 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GG G GG G GGG G Sbjct: 430 GGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGG 462 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GG G GG G GG G Sbjct: 67 GGGGGGIGGSGGVGAGGGVGGGAGGAIGG 95 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GG G Sbjct: 299 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGG 331 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GG G Sbjct: 367 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGG 399 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GGG G GG G GG G Sbjct: 414 GAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGG 446 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GG G G GG GGG G G G G + G + G G Sbjct: 517 GGAVGGGVGGAGRGSGGASGGAGAGGGAGG----GVGGGANVGVGVGAGGSTGGG 567 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G G G G G G GGGG G Sbjct: 43 GRGSVGVGAGAGGGASGGIGVGGGGGGGG 71 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGXGG-GXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G G GG G GG G Sbjct: 212 GASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGG 245 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGX-GGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GGG G Sbjct: 279 GGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGG 312 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GG GG G GGG GG G G G G GG Sbjct: 157 GGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGG 212 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GG G GG G GGG G Sbjct: 276 GGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGG 308 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +2 Query: 311 AGXEXGGGPXGX-GGGXGXTXGGXXGXXGGGGXXG 412 AG GGG G GGG G GG G GG G Sbjct: 338 AGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGG 372 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 326 GGGPXGXGG-GXGXTXGGXXGXXGGGGXXG 412 GGG G GG G G GG G GG G Sbjct: 374 GGGSVGGGGRGSGGASGGASGGASGGASGG 403 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 314 GXEXGGGPXG--XGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GGG G GG G G GG G Sbjct: 441 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTG 475 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG G GGG G + G G GGG G Sbjct: 64 GGGGGGGGGIGGSGGVGAGGGVGGGAGG 91 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 310 SGXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXG 411 SG GGG R G G G G G GG G Sbjct: 98 SGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAG 131 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 326 GGGPXGXGG-GXGXTXGGXXGXXGGGGXXG 412 GGG G GG G GG G G GG G Sbjct: 157 GGGGKGRGGKSGGGAGGGVGGGVGAGGGAG 186 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG G GGG G GG G GG G Sbjct: 265 GGNVGAGGGLGGGVGGGVGGGVGGSVGG 292 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGG-GGXXG 412 +G GG G GG G + G G GG GG G Sbjct: 317 SGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVG 351 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 +G GG G GG G GG G G GG G Sbjct: 397 SGGASGGASGGASGGVGGA-GGAGGSVGAGGGVG 429 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GG G Sbjct: 449 GGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAG 481 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGG-GGXXG 412 G GG G GGG G G G GG GG G Sbjct: 476 GSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVG 509 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G GGG G GG GGG G Sbjct: 80 GAGGGVGGGAGGAIGGGASGGAGGGGKG 107 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G G GG G GG G GG G Sbjct: 103 GGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVG 135 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 AG G G G GGG G GG G GG G Sbjct: 264 AGGNVGAG-GGLGGGVGGGVGGGVGGSVGGAVGG 296 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 AG G G G GGG G GG G GG G Sbjct: 332 AGGSVGAG-GGVGGGVGGGVGGGVGGGVGGAVGG 364 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGX-GGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GGG G Sbjct: 351 GGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRG 384 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGX-GXTXGGXXGXXGGGGXXG 412 +G GG G GG G GG G GG G G Sbjct: 385 SGGASGGASGGASGGASGGASGGASGGVGGAGGAG 419 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGX-GXTXGGXXGXXGGGGXXG 412 +G GG G GG G GG G G GG G Sbjct: 389 SGGASGGASGGASGGASGGASGGVGGAGGAGGSVG 423 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 AG G G G GGG G GG G GG G Sbjct: 418 AGGSVGAG-GGVGGGVGGGVGGGVGGAVGGAVGG 450 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGX-GGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GGG G Sbjct: 433 GGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRG 466 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P TP P P P P PPP PPPP P P PP PP Sbjct: 153 PPPPTPTPSVP-SPTP---PVPTDPMPSPPPPVSPPPP-TPTPSVPSPPDVTPTPP 203 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP-PXXPPPXAPXXPP 834 PP P TP P P P P P P P P P P P P P P PP Sbjct: 99 PPPPTPTPSVP-SPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 154 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR------XPXPPXXPPPXAP 822 PP P + P P P P PP PPPP P PP PPP P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 140 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +1 Query: 667 PPXPXATPGXXXG--PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P TP P P P P PP P P PP PPP P Sbjct: 135 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTP 188 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP-RXPXPPXXPPPXAP 822 P P TP P P P PPP P P P PP PPP P Sbjct: 106 PSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 158 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +1 Query: 667 PPXPXATPGXXXG--PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P TP P P P P PP PPPP P P P P Sbjct: 117 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDP 173 Score = 34.7 bits (76), Expect = 0.086 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 6/65 (9%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR------XPXPPXXP 807 GGG TP P P P P PP PPPP P PP P Sbjct: 60 GGGDDSGGDDGGYTPPAPVPPV--SPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 117 Query: 808 PPXAP 822 PP P Sbjct: 118 PPPTP 122 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 8/63 (12%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP----PPPRXPXP----PXXPPPXAP 822 P P TP P P P PPP P P P P P P PPP +P Sbjct: 124 PSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSP 183 Query: 823 XXP 831 P Sbjct: 184 PPP 186 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-XPXPPXXPPPXAPXXPP 834 P P TP P P P P P P P PP P PP P P P Sbjct: 160 PSVPSPTPPVPTDPMPSP-PPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTP 215 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 736 GXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 G P P P PPP P P PP +P P Sbjct: 71 GYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPP 102 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP-PPPRXPXPPXXPPPXAPXXPP 834 P P + P P P P P P P P P PP P P P P Sbjct: 93 PTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTP 149 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP-PPPRXPXPPXXPPPXAPXXPP 834 P P + P P P P P P P P P PP P P P P Sbjct: 111 PTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTP 167 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +1 Query: 652 GGXXXP-PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-PRXPXPPXXPPPXAPX 825 GG P P P +P P P P P P P P P PP P P P Sbjct: 70 GGYTPPAPVPPVSPPPPTPSVPSPTP-PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPS 128 Query: 826 XPP 834 P Sbjct: 129 PTP 131 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 7/63 (11%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPX------PXGXXPGXPPPXXPPPPR-XPXPPXXPPPXAPX 825 PP P TP P P P P P P P PP P PP P P Sbjct: 183 PPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPS 242 Query: 826 XPP 834 P Sbjct: 243 GSP 245 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P + P P P P P P P P PP P P P P P Sbjct: 177 PPPPVSPPPPTPTPSV---PSPPDVTPTPPTPSVPSPP--DVTPTPPTPSVPSPP 226 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXX-GPXXGQRPXPXGXXPGXPPPXXP----PPPRXPXPPXXPPPXAPXXP 831 PP P G G G P P PPP P P P PP P P P Sbjct: 53 PPSPGDDGGGDDSGGDDGGYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPT 112 Query: 832 P 834 P Sbjct: 113 P 113 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +1 Query: 667 PPXPX--ATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P + P P P P P P P P P PP PPP Sbjct: 202 PPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSG-SPPYVPPP 251 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-PPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P PPP PPP P PP PPP PP Sbjct: 49 PALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPP 105 Score = 34.7 bits (76), Expect = 0.086 Identities = 20/74 (27%), Positives = 24/74 (32%), Gaps = 8/74 (10%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP--------PPPRXPX 792 +P PP ++ G P P P PPP P PPP Sbjct: 8 SPPAPSADSAPPPDTSSDGSAAPPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSS 67 Query: 793 PPXXPPPXAPXXPP 834 PP P +P PP Sbjct: 68 PPPPPLDSSPPPPP 81 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P TP P P P PPP PPP P P P PP Sbjct: 78 PPPPDLTP-PPSSPPPPDAPPPIPIV--FPPPIDSPPPESTNSPPPPEVFEPPPPP 130 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 9/64 (14%) Frame = +1 Query: 667 PPXPXATPGXXXGPXX---GQRPXPXGXXPGXPP------PXXPPPPRXPXPPXXPPPXA 819 PP P P P P P P PP P PPPP PP P Sbjct: 97 PPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGG 156 Query: 820 PXXP 831 P P Sbjct: 157 PKKP 160 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P G + P PG P PP P P PP P PP Sbjct: 140 PPPPEQLPPPASSPQGGPKK-PKKHHPG---PATSPPA--PSAPATSPPAPPNAPP 189 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXG-PXXGQRPXPXGXXPGXPPPX---XPPPPRXPXPPXXPPPXAPXXPP 834 PP P A P P P P PP PPP P PPP PP Sbjct: 90 PPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPP 149 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPX-PXGXXPGXPPPXXPPPPRXPXPPXXP--PPXAPXXPP 834 PP P P Q P P P PP PPP PP P PP AP PP Sbjct: 82 PPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPP 140 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP---XXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P PPP PP P P P PP AP PP Sbjct: 97 PPQPPQSP-PASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPP 154 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P + P P P P P PPP + P P PP AP Sbjct: 119 PPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAP 170 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP--PRXPXPPXXPPPXAPXXPP 834 P P TP P P P PP PP P PP PPP AP PP Sbjct: 73 PPPAVTPTSPPAPKVA--PVISPATPPPQPPQSPPASAPTVSPPPVSPPP-APTSPP 126 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP-PXXPPPXAPXXP 831 P +P P P P P P PP P P P P PPP P Sbjct: 109 PTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSP 161 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/66 (27%), Positives = 20/66 (30%), Gaps = 1/66 (1%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPX 816 +P PP P P P P P P PP P P P P P Sbjct: 103 SPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPI 162 Query: 817 A-PXXP 831 + P P Sbjct: 163 SLPPAP 168 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/59 (28%), Positives = 18/59 (30%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP---PRXPXPPXXPPPXAPXXPP 834 PP A P P P P PPP P P P P +P PP Sbjct: 39 PPPTTAAPPTTAAPPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPP 97 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PP P P PA PP+ PP Sbjct: 120 PAPTSPPPTPASPPPAPASPPPAPASPPP 148 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PP P P PA PP+ PP Sbjct: 127 PTPASPPPAPASPPPAPASPPPAPVSPPP 155 Score = 27.9 bits (59), Expect = 9.9 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP--PPRXPXPPXXPPPXAPXXPP 834 PP A P P P P PPP P PP P P P PP Sbjct: 46 PPTTAAPPPTTTTPPVSAAQPPAS--PVTPPPAVTPTSPPAPKVAPVISPATPPPQPP 101 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP 654 GG G GG GG G GG GGG G G P P PG A G P Sbjct: 169 GGASGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAPGDKPGGAWGGKPGKKP 228 Query: 653 -PPPXGA 636 P GA Sbjct: 229 GHKPEGA 235 Score = 37.1 bits (82), Expect = 0.016 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 1/67 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP 654 GG G GG GG GG GGG G G G GP G A G P Sbjct: 153 GGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAP 212 Query: 653 -PPPXGA 636 P GA Sbjct: 213 GDKPGGA 219 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +2 Query: 311 AGXEXGGGPXGX-GGGXGXTXGGXXGXXGGGGXXGXPKXXP 430 +G GGGP G GGG G GG G GG P+ P Sbjct: 172 SGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAP 212 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP 654 GG G GG GG GG GG G G P PG A G P Sbjct: 149 GGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKP 208 Query: 653 PPPXG 639 G Sbjct: 209 EGAPG 213 Score = 33.1 bits (72), Expect = 0.26 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 1/67 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGP-XLXPGVAXGXGGXXX 657 GG G GG GG GG GG G G G GP G G G Sbjct: 145 GGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGAS 204 Query: 656 PPPPXGA 636 P GA Sbjct: 205 GDKPEGA 211 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 314 GXEXGGGPXGXGGGX-GXTXGGXXGXXGGGGXXGXP 418 G GGGP G GG G GG G GG G P Sbjct: 145 GGASGGGPGGASGGASGGASGGASGGASGGASGGGP 180 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 G G GG GG GG GG G G P PG A G G Sbjct: 141 GDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGG 195 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +2 Query: 311 AGXEXGGGPXGX-GGGXGXTXGGXXGXXGGGGXXG 412 +G GG G GGG G GG G GGG G Sbjct: 164 SGGASGGASGGASGGGPGGASGGGPGGASGGGPGG 198 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 314 GXEXGGGPXGXGGGX-GXTXGGXXGXXGGGGXXGXPKXXP 430 G GGGP G GG G G G GG G P P Sbjct: 189 GGASGGGPGGASGGASGDKPEGAPGDKPGGAWGGKPGKKP 228 Score = 29.5 bits (63), Expect = 3.2 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXG-PXLXPGVAXGXG-GXXXPPP 648 GA GGG G GG G GG G G G PG A G G G Sbjct: 136 GASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGG 195 Query: 647 PXGA 636 P GA Sbjct: 196 PGGA 199 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGX-GXTXGGXXGXXGGGGXXGXPKXXP 430 +G GG G GG G GG G GGG G P Sbjct: 156 SGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGP 196 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG G GGG GG G GGGG GGG G G Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G GGG GG G GG G GGG G G G Sbjct: 92 GGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRG 127 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GGG GG G GGGG GGG G G G Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRG 177 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG GGG GG G GGGG GGG G Sbjct: 154 GGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GG G G RG GG GGG G G G Sbjct: 88 GGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGG 124 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGG G Sbjct: 150 GYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 148 GGGYGGGGGGYGGGGG--YGGGGGGYGGGGRGG 178 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 +G GG G GGG G G G GGGG G Sbjct: 86 SGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYG 119 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGG 403 GG G GGG G GG G GGGG Sbjct: 159 GGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 G G GG G G RGGG GGG G GR Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGR 121 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXG 705 G GGG GG G GGG G G G G G + G Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRG 122 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 5/61 (8%) Frame = -1 Query: 833 GGXXGAXGGGXXG-GXGXRGGGGXXGGGXPG----XXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GGG G G G RGG G PG G G + G G G G Sbjct: 108 GGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGG 167 Query: 668 G 666 G Sbjct: 168 G 168 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG G GGG G GG G GGGG G Sbjct: 102 GGGRGSGGGYGG-GGGGYGGRGGGGRGG 128 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGG----GXXGGGXPG 744 GG G GGG G G GGG G GGG G Sbjct: 95 GGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGG 128 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGG 400 G GGG GGG G GG G GGG Sbjct: 155 GGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPX-PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P AT P P P P PP PPPP PP PPP A PP Sbjct: 78 PPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPP 133 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P TP P P P P PP PPP P P PPP PP Sbjct: 113 PPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSP-PQTTPPPPPAITPP 167 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP--PPRXPXPPXXPPPXAPXXPP 834 PP P TP P P P P PP PP+ PP PP P PP Sbjct: 105 PPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP--PRXPXPPXXPPPXAPXXPP 834 P P P P +P P PP PP P P PP PP PP Sbjct: 51 PQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPP 107 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PPP PP P P PPP PP Sbjct: 89 PPKPLPPP---LSPPQTTPPPPPAITP-PPPPAITPPLSPPPPAITPPPPLATTPP 140 Score = 35.5 bits (78), Expect = 0.049 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PP PPP PP PP P PP Sbjct: 44 PPPPQPDPQPPTPPTFQPAP-PANDQPPPPPQSTSPPPVATTPPALPP--KPLPPP 96 Score = 34.7 bits (76), Expect = 0.086 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P PP PPP P PPP A PP Sbjct: 72 PPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPP 114 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP 810 PP P TP P P PP PPPP PP PP Sbjct: 124 PPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPPLSPP 171 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P A P P P PP PPP P PPP PP Sbjct: 61 PAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPP 115 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP--PPXAPXXP 831 P P + P P P P P PP PPPP PP PP P P Sbjct: 94 PPPLSPPQTTPPPPPAITPPPP---PAITPPLSPPPPAITPPPPLATTPPALPPKP 146 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 6/61 (9%) Frame = +1 Query: 667 PPXPX---ATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP---RXPXPPXXPPPXAPXX 828 PP P PG Q P P P P PPPP P P PP P Sbjct: 32 PPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPK 91 Query: 829 P 831 P Sbjct: 92 P 92 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPX-XPPPXAPXXPP 834 PP P +T P P P PPP PP P PP PPP PP Sbjct: 70 PPPPQSTSP----PPVATTPPALPPKP-LPPPLSPPQTTPPPPPAITPPPPPAITPP 121 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 736 GXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G P PP PP P PP PP P P Sbjct: 255 GPSPTISPPPLPPQTLKPPPPQTTPPPPPAITP 287 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P PP PPP PP P P PP Sbjct: 256 PSPTISPPPLPPQTLKPPPPQTTPPPPPAITPPLSPP 292 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PG PPP P P P P P P A PP Sbjct: 42 PGPPPPQPDPQPPTP-PTFQPAPPANDQPP 70 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP 810 P + PG P P P PP PPPP PP PP Sbjct: 248 PQGFSCPGP--SPTISPPPLPPQTLKPPPPQTTPPPPPAITPPLSPP 292 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 721 RPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 R P G P P PPP P PPP PP Sbjct: 245 RRIPQGFSCPGPSPTISPPPLPPQTLKPPPPQTTPPPP 282 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP---XXPPPPRXPXPPXXPPPXA 819 PP A G + P P G P PPP PPPP PP PPP A Sbjct: 654 PPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPGA 707 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P G P PG PP PPPP PP PP P PP Sbjct: 649 PRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPP--PPGGGPPPPP 702 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P + G RP G G PPP PPP P PP P P PP Sbjct: 654 PPPRSAGGGKSTNLPSARPPLPG---GGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 35.1 bits (77), Expect = 0.065 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP 795 P GG P A P G P P G P PPP PPP P P Sbjct: 656 PRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPP--PPPGGGPPPPPPPP 705 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 325 GGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPE 435 GGGPP GG P G G G G PE Sbjct: 687 GGGPPPPPGGGPPPPPPPPGALGRGAGGGNKVHRAPE 723 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 535 PPXXGXAPXPXPPPXTXXGT*AGG 464 PP G P P PPP G AGG Sbjct: 691 PPPPGGGPPPPPPPPGALGRGAGG 714 Score = 28.3 bits (60), Expect = 7.5 Identities = 24/75 (32%), Positives = 25/75 (33%) Frame = -2 Query: 508 PXPPPXTXXGT*AGG*XGXGGRTGXXGXXFWGPXXPPPPXXPXXXPXGPAXXPPSXXGAP 329 P PPP + AGG G G PPPP P P P P P Sbjct: 652 PRPPPRS-----AGG--GKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPP 704 Query: 328 PXFXXRXVLXGXGGG 284 P R G GGG Sbjct: 705 PGALGR----GAGGG 715 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 761 GGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXPPPPXGA 636 GGG P P P GP PG GG PPPP GA Sbjct: 676 GGGPPPPPPP-----PGGGPPPPPG-----GGPPPPPPPPGA 707 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +2 Query: 266 GPPXPPPPPXXX*NXAGXEXGGGPXGXGGG--XGXTXGGXXGXXGGGG 403 GPP PPPPP GG P GGG G G GGG Sbjct: 678 GPPPPPPPP----------GGGPPPPPGGGPPPPPPPPGALGRGAGGG 715 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP PPPP P P PP P PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P P P PPP PPPP P PP PPP Sbjct: 67 PPPTSPPPPSPPPPSPPPP-SPPPPSPPPP 95 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P PPP PPPP P PP PPP P PP Sbjct: 64 PPPPPPTSPPPPSPPPP-SPPPPSPPPPSPP--PP 95 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXP 795 P P P P PPP PPPP P P Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPPXF 320 P PPPP P P P+ PPS PP F Sbjct: 69 PTSPPPPSPPPPSPPPPSPPPPSP--PPPAF 97 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP 777 PP P T P P P P PPP PPP Sbjct: 64 PPPPPPTSPPPPSP-----PPPSPPPPSPPPPSPPPP 95 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP PP PPP P P Sbjct: 293 PPTPTYSP-PVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTP 346 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP PP PPP P P Sbjct: 427 PPTPIYSPPVKPPPVH-KPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTP 480 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP PP PPP P P Sbjct: 477 PPTPTYSPPVQPPPVQ-KPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTP 530 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P P PP P P Sbjct: 444 PPTPIYSPPVKPPPVH-KPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTP 497 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P + P P P PPP PP PP PPP P Sbjct: 343 PPTPIYSPPVKPPPVH-KPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTP 397 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P + P P P PPP PP PP PPP P Sbjct: 360 PPTPIYSPPVKPPPVH-KPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTP 414 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P P PP P P Sbjct: 494 PPTPTYSPPVKPPPIQ-KPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTP 547 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P P PP P P Sbjct: 310 PPTPTYSPPIKPPPVQ-KPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTP 363 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P + P P P PPP PP PP PPP P Sbjct: 461 PPTPTYSPPIKPPPV--KPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTP 514 Score = 35.1 bits (77), Expect = 0.065 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P P P P P PPP PP PP PP P P Sbjct: 141 PPTPSYSPPVKPPPVQ-MPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTP 194 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P +P P + P P P PPP PP PP PPP Sbjct: 327 PPTPTYSPPIKPPPV--KPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPP 373 Score = 35.1 bits (77), Expect = 0.065 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP PP PP P P Sbjct: 377 PPTPIYSPPVKPPPIQ-KPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTP 430 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P +P P + P P P PPP PP PP PPP Sbjct: 175 PPTPTYSPPIK--PPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPP 221 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P +P P + P P P PPP PP PP PPP Sbjct: 511 PPTPTYSPPIKPPPV--KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 557 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/56 (35%), Positives = 22/56 (39%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P Q+P P P PPP PP PP PPP P Sbjct: 58 PPPPIYSPPIYPPPI--QKP-PTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP 110 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP + P P PP P PP Sbjct: 118 PPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKP--PP 171 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP + P P PP P PP Sbjct: 640 PPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKP--PP 693 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP + P P PP P PP Sbjct: 657 PPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKP--PP 710 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP + P P PP P PP Sbjct: 674 PPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKP--PP 727 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P PP PPP P P PP P PP Sbjct: 522 PPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKP--PP 574 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP + P P PP P PP Sbjct: 623 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKP--PP 676 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP P P PP P PP Sbjct: 202 PPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKP--PP 255 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/56 (32%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P + P P P PP PP PP PPP P Sbjct: 276 PPTPIYSPPVKPPPVH-KPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTP 330 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P PP PPP P P PP P PP Sbjct: 338 PPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKP--PP 390 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P P P P PP PPP + P P PP P Sbjct: 438 PPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPP 489 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P P P P PP PPP + P P PP P Sbjct: 488 PPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPP 539 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP P P PP P PP Sbjct: 538 PPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP--PP 591 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP P P PP P PP Sbjct: 572 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP--PP 625 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP P P PP P PP Sbjct: 589 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP--PP 642 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP P P PP P PP Sbjct: 606 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP--PP 659 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP + P P PP P PP Sbjct: 101 PPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKP--PP 154 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P P P P PP PPP P P PP P Sbjct: 135 PPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 186 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP + P P PP P PP Sbjct: 236 PPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKP--PP 289 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP--XAPXXPP 834 PP P P P P PP PPP + P P PP P PP Sbjct: 371 PPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPP 428 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP P P PP P PP Sbjct: 555 PPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP--PP 608 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP + P P PP P PP Sbjct: 84 PPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYP--PP 137 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P PP PP P Sbjct: 124 PPTPTYSPPIYPPPIQ-KPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSP 182 Query: 832 P 834 P Sbjct: 183 P 183 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP P P PP P PP Sbjct: 219 PPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKP--PP 272 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP + P P PP P PP Sbjct: 354 PPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKP--PP 407 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P PP PP P Sbjct: 411 PPTPTYSPPIKLPPV--KPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSP 468 Query: 832 P 834 P Sbjct: 469 P 469 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P PP PP P Sbjct: 527 PPTPTYSPPIKPPPVH-KPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSP 585 Query: 832 P 834 P Sbjct: 586 P 586 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P PP PP P Sbjct: 544 PPTPTYSPPIKPPPIH-KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSP 602 Query: 832 P 834 P Sbjct: 603 P 603 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P PP PP P Sbjct: 561 PPTPTYSPPIKPPPVH-KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSP 619 Query: 832 P 834 P Sbjct: 620 P 620 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P PP PP P Sbjct: 578 PPTPTYSPPIKPPPVH-KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSP 636 Query: 832 P 834 P Sbjct: 637 P 637 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P PP PP P Sbjct: 595 PPTPTYSPPIKPPPVH-KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSP 653 Query: 832 P 834 P Sbjct: 654 P 654 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P PP PP P Sbjct: 612 PPTPTYSPPIKPPPVH-KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSP 670 Query: 832 P 834 P Sbjct: 671 P 671 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P PP PP P Sbjct: 107 PPTPTYSPPIYPPPIQ-KPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSP 165 Query: 832 P 834 P Sbjct: 166 P 166 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/55 (32%), Positives = 20/55 (36%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PP PP P P PP P P Sbjct: 158 PPTPTYSPPIKPPPVH-KPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTP 211 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P PP PP P Sbjct: 208 PPTPIYSPPIKPPPVH-KPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSP 266 Query: 832 P 834 P Sbjct: 267 P 267 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P P P P PPP PP P PP PP P Sbjct: 259 PPTPIYSPPVKPPPVQTP-PTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSP 317 Query: 832 P 834 P Sbjct: 318 P 318 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/55 (32%), Positives = 20/55 (36%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PP PP P P PP P P Sbjct: 394 PPTPTYSPPIKPPPLQ-KPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTP 447 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P P P P PP PPP + P P P P Sbjct: 691 PPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSP 739 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP-----PPXAPXXP 831 PP P +P P + P P P PPP PP PP P PP P Sbjct: 90 PPTPTYSPPIYPPPIQ-KPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSP 148 Query: 832 P 834 P Sbjct: 149 P 149 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P PP PP P Sbjct: 225 PPTPTYSPPVKPPPVH-KPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSP 283 Query: 832 P 834 P Sbjct: 284 P 284 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P PP PP P Sbjct: 629 PPTPTYSPPIKPPPVH-KPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSP 687 Query: 832 P 834 P Sbjct: 688 P 688 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P + P P P PPP PP P PP PP P Sbjct: 646 PPTPTYSPPIKPPPVQ-KPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSP 704 Query: 832 P 834 P Sbjct: 705 P 705 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-PPPPRXPXPPXXPPPXAPXXP 831 PP P +P P P P P PPP PP P P PP P P Sbjct: 680 PPTPTYSPPVKPPPVQVP-PTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTP 734 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PP + P P PP P PP Sbjct: 270 PPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKP--PP 323 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXP 831 PP P +P P P P P PPP PP P PP PP P Sbjct: 663 PPTPTYSPPVKPPPVQ-LPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSP 721 Query: 832 P 834 P Sbjct: 722 P 722 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P P P P PP PPP P P PP Sbjct: 253 PPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPP 301 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 748 GXPPPXXPPPPRXPXPPXXPPP 813 G PP PPP PP PPP Sbjct: 50 GAPPSYTTPPPPIYSPPIYPPP 71 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P PP PPP P P PP P PP Sbjct: 186 PPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKP--PP 238 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P P P P PP PP + P P PP P Sbjct: 152 PPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPP 203 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P P P P PP PP + P P PP P Sbjct: 388 PPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPP 439 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P PP PPPP P PPP PP Sbjct: 494 PPPPVHSP-PPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PPP PPP P P PPP PP Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPP--PPPVHSPPPPVHSPPP 554 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP-RXPXPPXXPPPXAPXXPP 834 PP P P P P P PP PPPP P PP PP PP Sbjct: 561 PPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPP 617 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR--XPXPPXXPPPXAPXXPP 834 PP P P P P P PPP PPP P PP PP PP Sbjct: 590 PPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPP 647 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P P PPP P PP PP PP Sbjct: 520 PPPPVYSPPPPP-PVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 574 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PPP P PP PP P P Sbjct: 540 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSP 595 Score = 35.1 bits (77), Expect = 0.065 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP--RXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PPP P PP PP PP Sbjct: 597 PPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPP 654 Score = 34.7 bits (76), Expect = 0.086 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP-RXPXPPXX-PPPXAPXXPP 834 PP P P P P P PP PPPP P PP PPP PP Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPP--PPVHSPPPPVHSPPPPVHSPPPPVHSPPP 582 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P P PPP P PP PP PP Sbjct: 538 PPPPVHSP-----PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPP 588 Score = 34.7 bits (76), Expect = 0.086 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P P P P P PPP PPP PP PP +P P Sbjct: 580 PPPPVYSPP----PPPVHSPPPPVHSP--PPPVHSPPPPVYSPPPPPPVHSPPPP 628 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P P PPP P PP PP P P Sbjct: 609 PPPPVYSPPP---PPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSP 661 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 Q P P PP PPPP P PP +P PP Sbjct: 484 QSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPP 522 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP-RXPXPP-XXPPPXAPXXPP 834 PP P P P P PP PPPP P PP PPP P P Sbjct: 568 PPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSP 625 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PP PPPP PP P P PP Sbjct: 620 PPVHSPPPPVFSPPPPVHSPPPPVYSP-PPPVYSPPPPPVKSPPPPPVYSPPLLPP 674 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPX---XPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P PPP PPP P PP PP PP Sbjct: 511 PPPPVYSPPPPP-PVYSPPPPPPVYSP-PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 567 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/56 (32%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP + P P P PPP PPP PP PP +P PP Sbjct: 567 PPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPP--PPVYSPPPPP 620 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP--XXPPPXAPXXPP 834 PP P P P P P P PPP P PP PPP PP Sbjct: 547 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPP 604 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-XPXPPXXPPPXAPXXPP 834 PP P P P P P P PPPP P PP PP PP Sbjct: 554 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPP 610 Score = 32.7 bits (71), Expect = 0.35 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP--RXPXPPXXPPPXAPXXPP 834 PP P +P P P P P PP PPPP P PP PP P P Sbjct: 618 PPPPVHSPP----PPVFSPPPPVHSPP--PPVYSPPPPVYSPPPPPVKSPPPPPVYSP 669 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX---PPPPR-XPXPPXXPPPXAPXXPP 834 PP P +P P P P P PPP PPPP P PP PP PP Sbjct: 588 PPPPVHSP-----PPPVHSPPPPVHSP--PPPVYSPPPPPPVHSPPPPVFSPPPPVHSPP 640 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPP P P P PP +PP Sbjct: 532 PVYSPPPPPPVHSPPPPVHSPPPPVHSPP 560 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPP P P P PP +PP Sbjct: 612 PVYSPPPPPPVHSPPPPVFSPPPPVHSPP 640 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/56 (26%), Positives = 16/56 (28%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP + P P P PPP PP P PP P P Sbjct: 633 PPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSP 688 Score = 27.9 bits (59), Expect = 9.9 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP---PPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP P PP+ PP P +P PP Sbjct: 634 PPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSP--PP 690 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/69 (33%), Positives = 25/69 (36%) Frame = +1 Query: 628 AXXAPXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP 807 A AP G PP P P P P P PPP PP + PP P Sbjct: 371 APPAPPGPANQTSPPPPPPPSAAAPPP-----PPPPKKGPAAPPPPPPPGKKGAGPP-PP 424 Query: 808 PPXAPXXPP 834 PP + PP Sbjct: 425 PPMSKKGPP 433 Score = 32.7 bits (71), Expect = 0.35 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 415 GPXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 GP PPPP P GP PP PP Sbjct: 404 GPAAPPPPPPPGKKGAGPPPPPPMSKKGPP 433 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR---XPXPPXXPPPXAPXXPP 834 PP P A+P P P P PP PPPP P PP PP PP Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPP 633 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P PP PPPP P P PPP PP Sbjct: 552 PPPPVHSPPP---PVYSSPPPPHVYSP-PPPVASPPPPSPPPPVHSPPPPPVFSPP 603 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P P PPPP PP PPP PP Sbjct: 545 PPSPIYSPP----PPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPP 596 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP--XXPPPXAPXXPP 834 PP P P P PPP PPP P PP PPP PP Sbjct: 554 PPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPP 611 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-XPXPPXXPPPXAPXXPP 834 PP P P P P P P PPPP P PP PP PP Sbjct: 584 PPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPP 640 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP---PPXAPXXPP 834 PP + P P P P P PP PPPP PP P PP PP Sbjct: 569 PPHVYSPPPPVASPPPPSPPPPVHSPP-PPPVFSPPPPVFSPPPPSPVYSPPPPSHSPP 626 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXP-PPPRXPXPPXXPPPXAPXXPP 834 P P PPP P P P P P PPP PP Sbjct: 524 PPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPP 561 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXP-GXPPPXXPPPPRXPXP--PXXPPPXAPXXPP 834 P P P + P P P P P P P P P P P P P PP Sbjct: 443 PKPEEPENKHELPKQKESPKPQPSKPEDSPKPEQPKPEESPKPEQPQIPEPTKPVSPP 500 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPP--RXPXPP--XXPPPXAPXXPP 834 P P P P P PPP P PP PPP PP Sbjct: 536 PQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPP 576 Score = 29.5 bits (63), Expect = 3.2 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP----XXPPPXAP 822 PP P +P P P P P PP PPPP PP PP AP Sbjct: 602 PPPPVFSPPP---PSPVYSPPPPSHSP-PPPVYSPPPPTFSPPPTHNTNQPPMGAP 653 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPP P P P+ PP +PP Sbjct: 605 PVFSPPPPSPVYSPPPPSHSPPPPVYSPP 633 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GGG GG G GGGG GGG G Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GG GG G GGGG GGG G Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G + GG G GGG G GG G GGGG Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 341 GXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GGGG G Sbjct: 61 GDGGGDGGGDGGGGGCGGGGGCGG 84 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GGG GG G GGG GG G G G Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXG-GXXGXXGGGGXXG 412 GG G GGG G G G G GGGG G Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 G GGG GG G GGG GGG G G Sbjct: 60 GGDGGGDGGGDGG-GGGCGGGGGCGGGGGGG 89 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P Q P P PPP PPP P PP P PP Sbjct: 576 PPPPPPLPSRSIPPPLAQPPPPR-----PPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP--XXPPPXAPXXPP 834 PP P P P P PPP PP P PP PPP P PP Sbjct: 546 PPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPP 603 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-PRXPXPPXXPPPXAPXXPP 834 PP P A P P G PPP PPP + P PP P P PP Sbjct: 685 PPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPP 741 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P R P PP PPPP P P P AP PP Sbjct: 572 PPPPPPPP-----PPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPP 622 Score = 34.7 bits (76), Expect = 0.086 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP PPPP+ PP P PP Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLPP 706 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P A P P PPP PPP R P PPP P PP Sbjct: 613 PSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPP--PPPPP 665 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 13/69 (18%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX------------PPPPRXPXPPXXP- 807 PP P P P P P P PPP PPPP P P P Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPA 653 Query: 808 PPXAPXXPP 834 AP PP Sbjct: 654 AKCAPPPPP 662 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 8/64 (12%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPX--------GXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P T P P P P PPP PPPP P P Sbjct: 488 PPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPP 547 Query: 823 XXPP 834 PP Sbjct: 548 PPPP 551 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P P A P P P P P PPPP P PPP Sbjct: 696 PKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +1 Query: 652 GGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 G PP P P + P P P PPPP P PP P AP P Sbjct: 675 GPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPP--PPPPLSKTP-APPPP 731 Query: 832 P 834 P Sbjct: 732 P 732 Score = 29.9 bits (64), Expect = 2.5 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 13/68 (19%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGX--------PPPXXPPPPRXP-----XPPXXP 807 PP P + G Q P P P PPP PPP PP P Sbjct: 621 PPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTP 680 Query: 808 PPXAPXXP 831 PP P P Sbjct: 681 PPPPPPPP 688 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = -1 Query: 521 PXPXPXPPPXXXXRDLSRGVXGXGGAXRXSGGXLLGXPXAPPPPXXP 381 P P P PPP SG +G P PPPP P Sbjct: 640 PPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPP 686 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATP--GXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P G P P P PPP P P PP + PP Sbjct: 698 PPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Score = 29.5 bits (63), Expect = 3.2 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 11/67 (16%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-------PRXPXPPXXPPP---- 813 P A P P G PPP PPP P+ P PP PP Sbjct: 652 PAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRL 711 Query: 814 XAPXXPP 834 AP PP Sbjct: 712 GAPPPPP 718 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/55 (27%), Positives = 17/55 (30%) Frame = -1 Query: 521 PXPXPXPPPXXXXRDLSRGVXGXGGAXRXSGGXLLGXPXAPPPPXXPXXPXGSXP 357 P P PPP ++S LG P PPPP P P Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPP 731 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 4/30 (13%) Frame = +1 Query: 754 PPPXXPPPP----RXPXPPXXPPPXAPXXP 831 PPP PPPP P PPP P P Sbjct: 483 PPPPPPPPPLFTSTTSFSPSQPPPPPPPPP 512 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 747 RXPPPXXPPPPPXPXP 794 R PP PPPPP P P Sbjct: 673 RVGPPSTPPPPPPPPP 688 Score = 27.9 bits (59), Expect = 9.9 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -1 Query: 536 PPXPWPXPXPXPPPXXXXRDLSRGVXGXGGAXRXSGGXLLGXPXAPPPPXXPXXPXGSXP 357 PP P P P P PPP S S G A PPP P P P Sbjct: 594 PPPPRPPPPPPPPPSSRSIP-SPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIP 652 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +2 Query: 200 PXXXPXPXQXXXXXXRGLKXNXGPPXPPPPP 292 P P P R + PP PPPPP Sbjct: 595 PPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 27.9 bits (59), Expect = 9.9 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 2/65 (3%) Frame = -2 Query: 514 PXPXPPPXTXXGT*AGG*XGXGGRTGXXGXXFWGPXX--PPPPXXPXXXPXGPAXXPPSX 341 P P PPP T G GP PPPP P A PP+ Sbjct: 642 PPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAP 701 Query: 340 XGAPP 326 PP Sbjct: 702 PPLPP 706 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 4/59 (6%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP---XPPXXP-PPXAPXXPP 834 P P +TP P P P P P P PP P P PP P PP PP Sbjct: 534 PSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPP 592 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 1/65 (1%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP-PPX 816 P G P P + P P P PP PP P PP P PP Sbjct: 540 PTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPL 599 Query: 817 APXXP 831 P P Sbjct: 600 PPVIP 604 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP--PPPRXP--XPPXXPPPXAPXXP 831 P P TP P P P G P P P PP P P PP +P P Sbjct: 456 PSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTP 514 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP----PPRXPXPPXXPPPXAP 822 PP P + PG P P P P P PP PP P PPP P Sbjct: 567 PPTPIS-PGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTP 621 Score = 31.5 bits (68), Expect = 0.81 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 6/65 (9%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGX-----PPPXXPPPPRXPXPPXXPP 810 GG P P TPG P P P G P PP P PP P P PP Sbjct: 491 GGSPPSSPTTP--TPGGSP-PSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPP 547 Query: 811 -PXAP 822 P +P Sbjct: 548 SPSSP 552 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 1/65 (1%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP-PPX 816 P GG PP TP P G P P PP P PP P P Sbjct: 488 PTPGGS---PPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPG 544 Query: 817 APXXP 831 +P P Sbjct: 545 SPPSP 549 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 2/66 (3%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXG-PXXGQRPX-PXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P GG PP P P P G P P PG PP P P P PP Sbjct: 443 PSPGGS---PPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTP----TPGGSPP 495 Query: 814 XAPXXP 831 +P P Sbjct: 496 SSPTTP 501 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP-PXAPXXPP 834 P P P G P P P P PP P P PP P PP Sbjct: 407 PVVVPSPPTTPSPGGSPPSPSISPSPPIT-VPSPPTTPSPGGSPPSPSIVPSPP 459 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/58 (29%), Positives = 17/58 (29%), Gaps = 3/58 (5%) Frame = +1 Query: 670 PXPXATP---GXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P TP G P P PG PP P PP P P P Sbjct: 437 PSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSP 494 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P TP P P P PP PP P P PP +P Sbjct: 735 PPPPPTP--IHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSP 783 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 319 GXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPP 453 G GGG P GG G P G GGGG R PP PP Sbjct: 59 GKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPPVVVRPPP 103 Score = 34.3 bits (75), Expect = 0.11 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 5/68 (7%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXP-----XGXXPGXPPPXXPPPPRXPXPPXXPP 810 GGGG PP G P G+ P G G PP PPP PP Sbjct: 47 GGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPPVVVRPPPIIR 106 Query: 811 PXAPXXPP 834 P PP Sbjct: 107 PPPVVYPP 114 Score = 33.5 bits (73), Expect = 0.20 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 7/62 (11%) Frame = +1 Query: 286 PPXXXVKXSGXGXGGG--PPXXRGGXGXDPXGXXGXXGG-----GGAXGXPKRXPPEXRX 444 PP G G GGG PP GG G G GG GG G + PP R Sbjct: 35 PPVPKPPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRP 94 Query: 445 AP 450 P Sbjct: 95 PP 96 Score = 32.3 bits (70), Expect = 0.46 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP--RXP--XPPXXPPP 813 GGGG PP P P RP P PPP PPP R P PP PPP Sbjct: 82 GGGGGKSPPVVRPPPVVVRPPPI-IRPPPV----VYPPPIVRPPPITRPPIIIPPIQPPP 136 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +2 Query: 269 PPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXGGXXG--XXGGGGXXGXPKXXP 430 PP P PP G + G GGG GG G GGG G K P Sbjct: 35 PPVPKPPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPP 90 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP---XPPXXPPP 813 P P P P RP P P PP PPP P PP PP Sbjct: 101 PPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPPGLLPPITTPP 151 Score = 29.9 bits (64), Expect = 2.5 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 P GG G P G P RP P P PP PPP PP PP Sbjct: 67 PHGGKGGGPPHHGGGGGGGGKSPPV-VRPPPVVVRP---PPIIRPPPVVYPPPIVRPPPI 122 Query: 820 PXXP 831 P Sbjct: 123 TRPP 126 Score = 28.3 bits (60), Expect = 7.5 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 7/62 (11%) Frame = +1 Query: 670 PXPXATPGXXXGPXX---GQRPXPXGXXPGXPPPXXPPPPRXPX----PPXXPPPXAPXX 828 P P TP P G P P PG PP PP P PP PP + Sbjct: 134 PPPVTTPPGLLPPITTPPGLLP-PVTTPPGLLPPVTTPPGLLPPIINPPPVTVPPPSSGY 192 Query: 829 PP 834 PP Sbjct: 193 PP 194 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 730 PXGXXPGX--PPPXXPPPPRXPXPPXXPP 810 P G P PPP PPP PP PP Sbjct: 170 PPGLLPPIINPPPVTVPPPSSGYPPYGPP 198 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG R GG GGG G G GR G G + G GG Sbjct: 111 GGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 166 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRW 717 G G GG GG G R GGG GGG G G G W Sbjct: 133 GSGGGGGGRGYGGGGRREGGGY-GGGDGGSYGGGGGGW 169 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GG GG GGGG GGG G G G + G G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRG 142 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR-WPXXGPXLXPGVAXGXGG 666 GG G GGG G G GGG G G G GR + G G G GG Sbjct: 104 GGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGG 160 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GG GGG G + GG G GGGG Sbjct: 93 GRGGSGGGYRSGGGGGYSGGGGGGYSGGGG 122 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G G GG GGGG GGG G Sbjct: 95 GGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G G G GG GGGG GG G G G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGG 122 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +2 Query: 326 GGGPXGXGG-GXGXTXGGXXGXXGGGG 403 GGG G GG G G GG G GGGG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGG 114 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GGG GG GGGG G Sbjct: 91 GGGRGGSGGGYRSGGGGGYSGGGGGGYSG 119 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG G+ GG GG G GGG GGG G G R Sbjct: 92 GGRGGSGGGYRSGGGGGYSGGG--GGGYSGGGGGGYER 127 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GGG G G GGGG G Sbjct: 114 GGGYSGGGGGGYERRSGGYGSGGGGGGRG 142 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGG 400 G GGG GGG G GG G GGG Sbjct: 140 GRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGG--GGXXG 412 G GGG G GGG GG G GG GG G Sbjct: 133 GSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 167 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GG G GGG GG GGGG Sbjct: 95 GGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G E G G GGG G G G GGG G Sbjct: 124 GYERRSGGYGSGGGGGGRGYGGGGRREGGGYGG 156 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -1 Query: 818 AXGGGXXGGXGXRGG--GGXXGGGXPGXXPXGXGRWPXXG 705 A G GG G RGG GG GG G G G + G Sbjct: 82 AQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGG 121 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 +G GG G GGG GG GGGG Sbjct: 110 SGGGGGGYSGGGGGGYERRSGGYGSGGGGGG 140 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXP-PPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P +P P P P PP PPP P PP PP P PP Sbjct: 112 PKPPIVKPPTKPPPSTPKP-PTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPP 166 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P +P P P PP PPP P PP PPP P P Sbjct: 90 PHPKPPTVKPPHPKPPTKPHPHPKPPIVKPP-TKPPPSTPKPPTKPPPSTPKPP 142 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/54 (31%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +1 Query: 676 PXATPGXXXGPXXGQ-RPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P +TP P +P P P P PP P PP P P P P Sbjct: 124 PPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTP 177 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/55 (30%), Positives = 19/55 (34%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P + P PP PPP P PP PP + PP Sbjct: 102 PKPPTKPHPHPKPPIVKPPTKPPPSTPKPP--TKPPPSTPKPPTTKPPPSTPKPP 154 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P PP+ P P PP P PP Sbjct: 29 PPKPSPAPHKPPKHPVKPPKPPAVKPPKPP 58 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP--XPPXXPPPXAPXXPP 834 PP P P + P P P PP PP P+ P P PP P P Sbjct: 29 PPKPSPAPHKPPKHPV-KPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKP 85 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P P P P P P PP PP P PP Sbjct: 74 PKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPH-PKPPIVKPPTKP--PP 125 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXP---GXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P +P P P PP PPP P PP PP P P Sbjct: 128 PKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPP-TPTPP 183 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P P + P P PP P PP P P PP P P Sbjct: 128 PKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPP--PTPTPTPPVVTPPTP 180 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP---PRXPXPPXXPPPXAPXXP 831 PP P P P P P PP PP P P PP PP P P Sbjct: 147 PPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPP-TPTPP 203 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P TP P P P P P P PP P PP P Sbjct: 165 PPTPTPTPPVVTPPT----PTPPVITPPTPTPPVVTPPTPTPPVITPPTPTP 212 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP--XPPXXPPPXAPXXP 831 PP P A P P P PP P P+ P P PP P P Sbjct: 46 PPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHP 102 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP---PRXPXPPXXPPPXAPXXP 831 PP P P P P P P PP PP P P PP PP P P Sbjct: 159 PPTPCPPPTPTPTPPVVTPPTPT--PPVITPPTPTPPVVTPPTPTPPVITPP-TPTPP 213 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQ-RPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P TP P P P P P P PP P PP P P Sbjct: 190 PTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/55 (27%), Positives = 15/55 (27%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P PP PP P P P P P Sbjct: 65 PKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKP 119 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP-PPPRXPXPPXXPPPXAPXXP 831 P P P +P P P P P P P P PP PP P P Sbjct: 139 PKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPP-TPTPP 193 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG G GGGG GG G G G Sbjct: 11 GGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGG 47 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GG G GGGG GGG G G G+ G G G GG Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGG 123 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG G GG GGG G G G Sbjct: 15 GGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 35.9 bits (79), Expect = 0.037 Identities = 23/66 (34%), Positives = 24/66 (36%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP 654 GG G GG GG GGG GGG G G G G G G GG Sbjct: 84 GGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCG-GGGGGKGGKSGGGSGGGGYMVA 142 Query: 653 PPPXGA 636 P G+ Sbjct: 143 PGSNGS 148 Score = 34.7 bits (76), Expect = 0.086 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G+ GG G G G GG GGG G G G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCG 38 Score = 34.7 bits (76), Expect = 0.086 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G+ GGG GG G GGG GGG G G Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGG 40 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/30 (53%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXG-GGGXXG 412 GGG G GGG G + GG G G GGG G Sbjct: 78 GGGGKGGGGGGGISGGGAGGKSGCGGGKSG 107 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GGG G GG G GGGG G Sbjct: 102 GGGKSGGGGGGGKNGGGCGG--GGGGKGG 128 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G GGG G + GG G GGG G Sbjct: 8 GSGGGGKGGGGGGSGGGRGGGGGGGAKGG 36 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGXGGG-XGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 11 GGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSG 44 Score = 32.7 bits (71), Expect = 0.35 Identities = 23/78 (29%), Positives = 25/78 (32%) Frame = +1 Query: 304 KXSGXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSR 483 K G G GG GG G G GGG G P + + R Sbjct: 14 KGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRS---SYISRDNFE 70 Query: 484 XXXXGGGXGXGXGXGXGG 537 GG G G G G GG Sbjct: 71 SDPKGGSGGGGKGGGGGG 88 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGXG-GGXGXTXGGXXGXXGGGGXXG 412 G + G G G G GG G GG G GGGG G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKG 35 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXGXPK 421 GGG G GGG G GG G GG G K Sbjct: 11 GGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGK 42 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -1 Query: 806 GXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GG G GGG GGG G G G G G + G GG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGG 48 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP 654 G GG GG G +GGGG GG G G + G G G G P Sbjct: 2 GGKGGSGSGGGG-KGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAP 56 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 G G GGG G G RGGGG GG G G Sbjct: 8 GSGGGGKGGGGGGSGGGRGGGGG-GGAKGGCGGGG 41 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G G GGGG G Sbjct: 18 GGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGX-GGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGG G Sbjct: 104 GKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPG 687 G G GGG G G GGGG G G G G + PG Sbjct: 10 GGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPG 57 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGX-GGGXGXTXGGXXGXXGGGGXXG 412 G + GGG G GGG G G G GGGG G Sbjct: 80 GGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGG 113 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGXG-GGXGXTXGGXXGXXGGGGXXG 412 G GGG G G GG GG G GGGG G Sbjct: 83 GGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNG 116 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGG 400 G + GGG G GGG G GG G GGG Sbjct: 112 GGKNGGGCGGGGGGKGGKSGG--GSGGGG 138 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 311 AGXEXG-GGPXGXGGGXGXTXGGXXGXXGGG 400 AG + G GG GGG G GG G GGG Sbjct: 95 AGGKSGCGGGKSGGGGGGGKNGGGCGGGGGG 125 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGXGG-GXGXTXGGXXGXXGGGGXXG 412 G GGG G G G G + GG G GGG G Sbjct: 88 GGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGG 121 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 311 AGXEXGGGPXGXG--GGXGXTXGGXXGXXGGGGXXGXP 418 +G GGG G G GG G G G GGGG P Sbjct: 106 SGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGGYMVAP 143 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GGG GG GGGG G Sbjct: 19 GGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXGXPK 421 G G G GGG GG G GGG G K Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAK 34 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG GA GG GG GGGG PG Sbjct: 28 GGGGGAKGGCGGGGKSGGGGGGGGYMVAPG 57 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXG 705 G GGG GG G GGGG GGG G G W G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWG 108 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXGXPK 421 G GGG G GGG G GG G GGGG G K Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYK 106 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG G G G GGG G G G Sbjct: 74 GGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCG 110 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G GGG GG G GGGG GGG G G G Sbjct: 63 GSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGG 99 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXG 705 G G GGG GG G GGGG G G G +W G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGG 111 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG G GGG GG G GGG GGG G G+ Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGK 114 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG G GGG GG G GGGG G G G G+ Sbjct: 79 GGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGK 116 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G G GG G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG GGGG G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG G GGGG GGG G G G G G G G Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKG 115 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 5/44 (11%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGG-----XXGGGXPGXXPXGXGRW 717 GG G GGG G G GGGG GGG G G G + Sbjct: 81 GGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRGEF 124 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G G G GG G GGGG G Sbjct: 61 GSGSYRWGWGGGGGGGGGGGGGGGGGGGG 89 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 5/35 (14%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXG-----XXGGGG 403 G GGG G GGG G GG G GGGG Sbjct: 79 GGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXX--PPPXAPXXPP 834 PP P P P P P PPP PPPP P P PPP +P PP Sbjct: 504 PPPPEYEPSPPP-PSSEMSPSVRAYPP--PPPLSPPPPSPPPPYIYSSPPPPSPSPPP 558 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 10/66 (15%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX---------PPPPR-XPXPPXXPPPX 816 PP +P P P P P PPP PPPP P PP PPP Sbjct: 488 PPSSKMSPSVKAYPPP---PPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPY 544 Query: 817 APXXPP 834 PP Sbjct: 545 IYSSPP 550 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX--PPPPRXPXPPXXPPPXAP 822 PP P +P P P P PPP PPP PP P P Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPP 581 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP---XXPPPPRXPXPPXXPPPXAPXXPP 834 PP +P P P P P PPP PPP P P PPP PP Sbjct: 515 PPSSEMSPSVRAYPP----PPPLSPPPPSPPPPYIYSSPPPPSPSP---PPPYIYSSPP 566 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +1 Query: 688 PGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----PRXPXPPXXPPPXAPXXPP 834 P P P P P PPP PPP P P P PP PP Sbjct: 516 PSSEMSPSVRAYPPPPPLSP--PPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 567 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP-XXPPPPRXPXP-PXXPPPXAPXXPP 834 PP TP P P P PPP PP + P P P PP PP Sbjct: 649 PPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPP 706 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P PP PPPP PP PPP PP Sbjct: 519 PPAPVNSPPP---PVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXP---PPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P P PP PPP P PP PP PP Sbjct: 526 PPPPVYSPPPPPPPVHSP-PPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPP 583 Score = 37.1 bits (82), Expect = 0.016 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP-XXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P PPP PPPP PP PP PP Sbjct: 589 PPPPVHSPPP---PAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPP 642 Score = 36.7 bits (81), Expect = 0.021 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP-XXPPPXAPXXPP 834 PP P +P P P P P P PPP P PP PPP AP P Sbjct: 551 PPPPVYSPPPPPPPVHS--PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSP 605 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P P P P P P P PPP PP PP +P P Sbjct: 575 PPPPVYSP-----PPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPP 624 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PPP P P PPP PP Sbjct: 577 PPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPP--PPPVYSPPPPVFSPPP 630 Score = 35.1 bits (77), Expect = 0.065 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P P P P P PPP PPP PP PP +P P Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPP--PPVYSPPPP 585 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P +R P PPP PPP P P PPP PP Sbjct: 511 PVTKRRSPPPAPVNSPPPPVYSPPP-PPPPVHSPPPPVHSPPP 552 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP---RXPXPP-XXPPPXAPXXPP 834 PP P P P P P PP PPPP P PP PPP P P Sbjct: 563 PPVHSPPPPVFSPPPPVYSPPPPVHSP-PPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSP 621 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 Q P P P PPPP PP PP +P P Sbjct: 509 QSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPP 546 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-PPPPRXP---XPPXXPPPXAP 822 PP P +P P P P PP PPPR P PP PP AP Sbjct: 605 PPPPVHSPPPPP-PVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAP 659 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/52 (34%), Positives = 20/52 (38%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P +P P P P P PP PPP + P PPP P Sbjct: 598 PPAPVHSPPP---PVHSPPPPPPVYSP-PPPVFSPPPSQSPPVVYSPPPRPP 645 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP + P P P PPP PP P PP PP PP Sbjct: 576 PPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPP--PPPPVYSPPPPVFSPP 629 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 403 PPPPXXPXXXPXGPAXXPPSXXGAPP 326 PPPP P P P PP +PP Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPP 583 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 5/57 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP-----PXXPPPXAP 822 PP + P P Q P P PP PP + P P PP AP Sbjct: 615 PPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKETPPAHAP 671 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P G PPP PP P PP PPP P Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPP 43 Score = 34.7 bits (76), Expect = 0.086 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P G P G PP PPPP P PP PPP Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPP--PPPPPPPPP 44 Score = 31.5 bits (68), Expect = 0.81 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 760 PXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPPP P PPP P PP Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPPP 41 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PG P PPP P PPP P PP Sbjct: 13 PGNYPQGPPPPVGVPPQYYPPPPPPPPPPP 42 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 676 PXATPGXXX-GPXXGQRPXPXGXXPGXPPPXXPPPPR 783 P PG GP P P PPP PPPPR Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPPR 45 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-PRXPXPPXXPPPXAPXXP 831 PP P TPG P P PG PP P P P P P PPP P Sbjct: 205 PPSPSPTPGPD-SPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTP 259 Score = 33.9 bits (74), Expect = 0.15 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXG-PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP TPG P G P P PG P P P P P P P P P Sbjct: 233 PPSSSPTPGPDSPLPSPGPPPSP-SPTPGPDSPLPSPGPDSPLPSPGPDPPLPSPGP 288 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXG-PXXG-QRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P TPG P G P P P P P P P P P P PP Sbjct: 177 PPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPP 234 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP PPPP P P PPP +P P Sbjct: 161 PPLPPPPP--PYPSPLPPPPSPSPTP 184 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/58 (34%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXG-PXXGQRPXPXGXXPGXPPPXXPPPPRXPXP-PXXPPPXAPXXPP 834 P P +PG P G P P PG P P P P P P PP +P P Sbjct: 186 PDSPLPSPGPDSPLPLPGPPPSP-SPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGP 242 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPP-XXPPPPRXPXPPXXPPPXAPXXPP 834 P P +P GP P P P P P PPP P P P +P PP Sbjct: 202 PGPPPSPSPTPGP---DSPLP-SPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPP 253 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P PPP P P P PP P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSP 189 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/69 (27%), Positives = 22/69 (31%), Gaps = 3/69 (4%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXP---GXPPPXXPPPPRXPXPPXXP 807 +P G P +P GP P P P PPP P P P P Sbjct: 209 SPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSP 268 Query: 808 PPXAPXXPP 834 P +P P Sbjct: 269 GPDSPLPSP 277 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP P P P P P P +P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSP 193 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP 810 P P P +PG P P P P P P P P P PP P Sbjct: 233 PPSSSPTPGPDSPLPSPGPPPSP--SPTPGPDSPLPS-PGPDSPLPSPGPDPPLPSP 286 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P P P P P PG P P P P P PPP P Sbjct: 164 PPPPPPYPSPLPPP-----PSP-SPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTP 212 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/58 (31%), Positives = 21/58 (36%) Frame = -1 Query: 536 PPXPWPXPXPXPPPXXXXRDLSRGVXGXGGAXRXSGGXLLGXPXAPPPPXXPXXPXGS 363 PP P+P P P PP + G S L G P +P P P P S Sbjct: 166 PPPPYPSPLPPPPSPSPTPGPDSPLPSPG---PDSPLPLPGPPPSPSPTPGPDSPLPS 220 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP P P P P PP Sbjct: 161 PPLPPPPPPYPSPLPPPP 178 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/65 (26%), Positives = 19/65 (29%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPX 816 +P G P +P GP P P P P P P PP P Sbjct: 181 SPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTP 240 Query: 817 APXXP 831 P P Sbjct: 241 GPDSP 245 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG G GGG GG G GGGG GGG Sbjct: 131 GGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GG GG G GGGG GGG G Sbjct: 125 GGYSGGGGGYGGGGGGYGGGGGGYGGGGDG 154 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G GG GG G GGGG GGG G G G Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDG 154 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 281 PPPPXXX*NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 P P G GGG G GGG G GG G GGG G Sbjct: 115 PSAPRAYGGGGGYSGGGG--GYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGG-GXXGGGXPGXXPXGXG 723 GG G GGG GG G GGG G GGG G G G Sbjct: 122 GGGGGYSGGG--GGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGG 400 G GGG G GGG G GG G GGG Sbjct: 131 GGGYGGGGGGYGGGGGGYGGG--GDGGGG 157 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXP--XPPXXPPPXAPXXPP 834 P P P PPP PPP P PP PP +P PP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P PPP P PP PP PP +P P Sbjct: 406 PIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSP 440 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP--XXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P PP PPPP PPP PP Sbjct: 411 PPPPPPSPPLPP-PVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPP 467 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP PPP P PP PP +P P Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSP 431 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPX 825 G G P P P P P P PP PPP P PP Sbjct: 395 GCGRSVVKPSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYS 454 Query: 826 XPP 834 PP Sbjct: 455 SPP 457 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP + P P P P P PP PPPP PP PP P PP Sbjct: 56 PPPVYSRPVAFPPPPPIYSPPPPPIYP--PPIYSPPPPPIYPPPIYSPPPTPISPP 109 Score = 36.3 bits (80), Expect = 0.028 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATP-GXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P RP P PP PPPP PP PP P PP Sbjct: 43 PPPPYRSPVTIPPPPPVYSRPVAF---PPPPPIYSPPPPPIYPPPIYSPPPPPIYPP 96 Score = 31.5 bits (68), Expect = 0.81 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP-PXXPPPXAPXXPP 834 PP P +P P P P P PPP PPP P P P PPP P Sbjct: 68 PPPPIYSP-----PPPPIYPPPIYSPP--PPPIYPPPIYSPPPTPISPPPKVHHPAP 117 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 745 PGXPPPXXPP-PPRXPXPPXXPPPXAPXXPP 834 P PP PP PP P PP PP AP PP Sbjct: 1129 PHESPPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXX----PPPXAPXXP 831 P P P PPP PP P PP PPP AP P Sbjct: 1134 PSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAP 1173 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 748 GXPP-PXXPPPPRXPXPPXXPPPXAPXXPP 834 G PP P PP P PP PPP P PP Sbjct: 1124 GSPPLPHESPPSPPPQPPSSPPP--PSSPP 1151 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PP PPP P PPP PP Sbjct: 1137 PPQPPSSPPPPSSPPQLAPAPPPSDHCLPP 1166 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXG 675 GG G+ G GG G GGGG GGG G G G G G G Sbjct: 108 GGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 G G+ GG G RG GG GGG G G GR G G G G Sbjct: 100 GSHAGSGSGGRSGSGRGRGSGG--GGGHGGGGGGGGGRGGGGGSGNGEGYGEGGG 152 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G G G GGG G Sbjct: 127 GGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGG 159 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGG 403 GG G G G G GG G GGGG Sbjct: 108 GGRSGSGRGRGSGGGGGHGGGGGGG 132 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGG 403 G G GGG G GG G GGGG Sbjct: 116 GRGSGGGGGHGGGGGGGGGRGGGGG 140 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GGG G GGG G GG G G G Sbjct: 121 GGGGHGGGGGGGGGRGGGGGSGNGEG 146 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G G G G GGG G Sbjct: 123 GGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGG 155 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G G G Sbjct: 118 GSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEG 150 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXG-XTXGGXXGXXGGGGXXG 412 G G G GGG G GG G GGGG G Sbjct: 109 GRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSG 142 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 AG G G G G G G GGGG G Sbjct: 99 AGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGG 132 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXG 411 G G GGG RGG G G GGG G Sbjct: 124 GHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGG 156 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP-RXPXPPXXPPPXAPXXPP 834 PP P +P P P P P PP PPPP P PP PP PP Sbjct: 744 PPAPIYSPP----PPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 796 Score = 37.1 bits (82), Expect = 0.016 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP-RXPXPPXXPPPXAPXXPP 834 PP P +P P P P P PP PPPP P PP PP PP Sbjct: 663 PPPPMHSP-----PPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 714 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/62 (30%), Positives = 21/62 (33%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPX 825 GGGG P P TP + P P P P P P+ P P P P Sbjct: 399 GGGGGGSNPSPKPTPTPKAPEPKKEINPPNLEEPSKPKPEESPKPQQPSPKPETPSHEPS 458 Query: 826 XP 831 P Sbjct: 459 NP 460 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP--XXPPPXAPXXPP 834 PP P P P P P P PPP + P PP PPP AP P Sbjct: 694 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSP 751 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P P P P P PP PPPP P PP +P P Sbjct: 708 PPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPP 762 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PPP P PP PP P P Sbjct: 687 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSP 742 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP-RXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPPP P PP PP PP Sbjct: 665 PPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 721 Score = 35.5 bits (78), Expect = 0.049 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP--RXPXPPXXPPPXAPXXPP 834 PP P +P P P P P PP PPPP P PP PP PP Sbjct: 735 PPPPVFSP-PPPAPIYSPPPPPVHSPP--PPVHSPPPPPVHSPPPPVHSPPPPVHSPP 789 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P P PPP P PP PP PP Sbjct: 677 PPPPVHSPP----PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 728 Score = 34.7 bits (76), Expect = 0.086 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP-RXPXPPXXPPPXAPXXPP 834 PP P +P P P P P PP PPPP P PP PP PP Sbjct: 752 PPPPVHSPPP---PVHSPPPPPVHSPP--PPVHSPPPPVHSPPPPVHSPPPPVHSPP 803 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXX-PPPXAPXXPP 834 PP P +P P P P P P PPP P PP PPP PP Sbjct: 685 PPPPVHSP-----PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPP 736 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P PP PPPP PP P +P PP Sbjct: 701 PPVHSPPPPVHSPPPPVHSPPPPVHSP-PPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/56 (35%), Positives = 22/56 (39%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P P PPPP PP PP +P PP Sbjct: 720 PPPPVHSPPP---PVQSPPPPPVFSPPPPAPIYSPPPPPVHSPP--PPVHSPPPPP 770 Score = 34.3 bits (75), Expect = 0.11 Identities = 22/58 (37%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP-RXPXPP-XXPPPXAPXXPP 834 PP P +P P P P P PP PPPP P PP PPP +P P Sbjct: 759 PPPPVHSPPP---PPVHSPPPPVHSPP--PPVHSPPPPVHSPPPPVHSPPPPSPIYSP 811 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-XPXPPXXPPPXAPXXPP 834 PP P P P P P P PPPP P PP PP PP Sbjct: 651 PPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPP 707 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR---XPXPPXXPPPXAPXXP 831 PP P P P P P PP PPPP P PP PP P P Sbjct: 769 PPVHSPPPPVHSPPPPVHSPPPPVHSP-PPPVHSPPPPSPIYSPPPPVFSPPPKPVTP 825 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-XPXPPXXPPPXAPXXPP 834 PP P P Q P P P PP PPPP P PP PP PP Sbjct: 626 PPSPSTEETKTTSP---QSP-PVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPP 678 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPP-RXPXPPXXPPPXAPXXPP 834 P P P PP PPPP P PP PP PP Sbjct: 642 PPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPP 685 Score = 32.3 bits (70), Expect = 0.46 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP--RXPXPPXXPPPXAPXXPP 834 PP P +P P P P P PP PPPP P PP PP PP Sbjct: 649 PPPPVHSPP----PPVFSPPPPMHSPP--PPVYSPPPPVHSPPPPPVHSPPPPVHSPP 700 Score = 31.5 bits (68), Expect = 0.81 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P P P P P P P PPP PP P P P P Sbjct: 776 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPP--PKPVTPLPP 828 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P P PPPP PP P P P Sbjct: 781 PPPPVHSPP----PPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSP 832 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/52 (26%), Positives = 15/52 (28%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P P + P P P P PP P P P P P Sbjct: 504 PESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPP 555 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPP P P P PP +PP Sbjct: 643 PVHSPPPPPPVHSPPPPVFSPPPPMHSPP 671 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/56 (26%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P + P P P P P P+ P P +P P Sbjct: 516 PPKPEESPKPEP-PKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQP 570 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG G GG GG G GGGG GGG G G Sbjct: 100 GGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGG 134 Score = 35.9 bits (79), Expect = 0.037 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGV 684 GG G GGG GG GGGG GGG G G G PGV Sbjct: 107 GGHYGGGGGGHGGGGHYGGGGGGYGGG--GGHHGGGGHGLNEPVQTKPGV 154 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 107 GGHYGGGGGGHGGG-GHYGGGGGGYGGGGGHHG 138 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG G G GGGG GGG G G G + G G GG Sbjct: 60 GHGGHNGGGGHGLDGYGGGGGHYGGGG-GHYGGGGGHYGGGGGHYGGGGGHYGGG 113 Score = 33.9 bits (74), Expect = 0.15 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXR-GGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG GG G GGGG GG G G G G G G GG Sbjct: 78 GGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGG 134 Score = 33.1 bits (72), Expect = 0.26 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXR--GGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG GG G GGGG GGG G G G + G G GG Sbjct: 85 GGGHYGGGGGHYGGGGGHYGGGGGHYGGG--GGGHGGGGHYGGGGGGYGGGGGHHGGG 140 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGG---XXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG G G GGGG GG G G G + G G GG Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGG 106 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G G G GGGG G Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYG 83 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G GG GGGG G Sbjct: 79 GGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYG 111 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G GG GGGG G Sbjct: 86 GGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHG 118 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G GG G GGG G Sbjct: 93 GGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGG 125 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G GG GGGG G Sbjct: 100 GGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGG 132 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG GGG G GG GGGG G Sbjct: 76 GGGGGHYGGGGGHYGGGGGHYGGGGGHYG 104 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G GG G GGG G Sbjct: 101 GHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGG 133 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G GGG G GG GGGG G Sbjct: 69 GHGLDGYGGGGGHYGGGGGHYGGGGGHYG 97 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GGG GG G GGG G Sbjct: 92 GGGHYGGGGGHYGGGGGHYGGGGGGHGGG 120 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG G GGG GG G GGGG Sbjct: 115 GGHGGGGHYGGGGGG---YGGGGGHHGGGG 141 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GGG G G GGGG GG G G + G G GG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGG 92 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GGG G GG G G G GGGG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGG 69 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXG 385 G GGG G GGG G GG G Sbjct: 120 GGHYGGGGGGYGGGGGHHGGGGHG 143 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 37.1 bits (82), Expect = 0.016 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPPXAP 822 PP PPPP P PP PPP P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 32.7 bits (71), Expect = 0.35 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPP P PP Sbjct: 263 PNRPPPPSSPPPPPPPPP 280 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXP 807 P PPP PPP P PP P Sbjct: 263 PNRPPPPSSPPPPPPPPPTPP 283 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPP 810 PPP PPPP P PP PP Sbjct: 267 PPPSSPPPP--PPPPPTPP 283 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Frame = +3 Query: 747 RXPPPXXPPPPP--XPXPP 797 R PPP PPPPP P PP Sbjct: 265 RPPPPSSPPPPPPPPPTPP 283 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAP 822 PP PPP P PP PPP P Sbjct: 262 PPNRPPPPSSPPPPP--PPPPTP 282 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 775 PPRXPXPPXXPPPXAPXXP 831 PP P PP PPP P P Sbjct: 262 PPNRPPPPSSPPPPPPPPP 280 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 PP A P P P P P P P PPPP+ PP PP A Sbjct: 259 PPGRSAPP-----PPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGA 304 Score = 37.1 bits (82), Expect = 0.016 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PP PPPP P P PPP PP Sbjct: 269 PAAAPPPQPPPPPPPKPQPPPPPKIARPPP 298 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PG P PP P P PPP P PP Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPP 289 Score = 32.3 bits (70), Expect = 0.46 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P PP PPP P PP P P P Sbjct: 260 PGRSAPPPPPAAAPPPQPPPPPPPKPQPPPP 290 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPR--XPXPPXXPPPXAP 822 P G PPP PPP+ P PP PP P Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P PPP P P P P PP AP Sbjct: 268 PPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAP 300 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 748 GXPPPXXPPPPRXPXPP--XXPPPXAPXXPP 834 G PP PP P PP PPP P PP Sbjct: 252 GLPPLKLPPGRSAPPPPPAAAPPPQPPPPPP 282 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/49 (28%), Positives = 15/49 (30%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPPXFXXRXVLXGXGGGXGXGGA 266 P PPP P P P PP PP + G G A Sbjct: 269 PAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAPKRQGNTSSGDA 317 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 5/57 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP-----XXPPPPRXPXPPXXPPPXAP 822 PP P P P P P PPP PPP P PP PPP P Sbjct: 15 PPSPPTNSTTTTPPPAASSPPPT-TTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPP 70 Score = 37.1 bits (82), Expect = 0.016 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 10/58 (17%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQ----------RPXPXGXXPGXPPPXXPPPPRXPXPPXXPP 810 PP P + P GP GQ RP PPP P PPR P PP PP Sbjct: 179 PPPPPSGP-KAGGPYGGQQQYWQQQNASRPSDNHVVTSLPPPKPPSPPRKPPPPPPPP 235 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P +P P Q P P P P PR P P PP P Sbjct: 62 PSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNTP 113 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P G P P P P P P P P P P P P Sbjct: 59 PLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNTP 113 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/64 (28%), Positives = 19/64 (29%), Gaps = 8/64 (12%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP--------PRXPXPPXXPPPXAP 822 P P +P P P P PP PP P P PP P P Sbjct: 40 PSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNP 99 Query: 823 XXPP 834 PP Sbjct: 100 RSPP 103 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PG P PP P PPP A PP Sbjct: 7 PGTTPSPSPPSPPTNSTTTTPPPAASSPPP 36 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +1 Query: 670 PXPXATPGXXX-GPXXGQR-PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P TP P P P P PP PP P P P P AP P Sbjct: 34 PPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQ-PSPSAPITP 88 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/43 (30%), Positives = 14/43 (32%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P G P P P PPP PP P +P P Sbjct: 5 PSPGTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSP 47 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXP--XPPXXPPPXAPXXPP 834 P P P PPP PPPP P PP P P PP Sbjct: 54 PEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPP 92 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 7/55 (12%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-------PPPPRXPXPPXXPPP 813 P P TP P P P PPP PPPPR P PP PPP Sbjct: 63 PPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPR-PLPPPPPPP 116 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P P PPPP PPP P PP Sbjct: 63 PPPPQTPPPP---PPPQSLPPPS---PSPEPEHYPPPPYHHYITPSPPPPRPLPPP 112 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 717 PTARXXGXXPRXPPPXXPPPPPXP 788 P+ P PPP PPPPP P Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPP 75 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPX--GXXPGXPPPXXPPPPRXPXP 795 PP P + P P P P PPP P PP P P Sbjct: 72 PPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPP 116 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 37.1 bits (82), Expect = 0.016 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P A P P P P P P P PP P PP PP P P Sbjct: 110 PPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDP 162 Score = 35.5 bits (78), Expect = 0.049 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP--PPRXPXPPXXPPPXAPXXPP 834 PP P T P P P PP PP P P PP PPP P PP Sbjct: 100 PPPPLPTEAPPPANPVSS-PPPESSPPPPPPTEAPPTTPITSPSPPTNPPPP-PESPP 155 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P GP P P PPP P P PPP + PP Sbjct: 72 PPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPP 127 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P T P P P P PPP PP P PP P P PP Sbjct: 124 PPPPPPTEAPPTTPITS--PSPPTNPP--PPPESPPSLPAPDPPSNPLPPPKLVPP 175 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP---XXPPPXAPXXPP 834 PP P +P P P P P PP PP P PP PPP PP Sbjct: 147 PPPPPESPPSLPAPDPPSNPLPP---PKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPP 202 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P + P P PP PPPP PP PP P P Sbjct: 95 PPEPSPPP-----PLPTEAPPPANPVSSPPPESSPPPP----PPTEAPPTTPITSP 141 Score = 31.9 bits (69), Expect = 0.61 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXX--PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P TP P P P P PP P PP PP PP PP Sbjct: 133 PPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPP 187 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P ++P P P PP P PP P P PPP P P Sbjct: 64 PETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPP-PPLPTEAPPPANPVSSP 118 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = +1 Query: 637 APXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPX 816 AP PP + P P P PPP PP P P PP Sbjct: 108 APPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAP---DPPS 164 Query: 817 APXXPP 834 P PP Sbjct: 165 NPLPPP 170 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/50 (28%), Positives = 18/50 (36%) Frame = +1 Query: 685 TPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 +P P ++P P G P P P + P P P P PP Sbjct: 218 SPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPP 267 Score = 29.1 bits (62), Expect = 4.3 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 6/62 (9%) Frame = +1 Query: 667 PPXPXAT--PGXXXGPXXGQRPXPXGXXPGX-PPPXXP---PPPRXPXPPXXPPPXAPXX 828 PP P T P P P P PPP P PPP PP PP AP Sbjct: 77 PPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPE-SSPPPPPPTEAPPT 135 Query: 829 PP 834 P Sbjct: 136 TP 137 Score = 28.3 bits (60), Expect = 7.5 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX--PPP---PRXPXPPXXPPPXAPXXP 831 PP TP P P P P P PPP P P P PPP P Sbjct: 50 PPETTNTPAQSSPPPETPLSSPP-PEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEA 108 Query: 832 P 834 P Sbjct: 109 P 109 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 412 PXXPPPPXXPXXXPXGPAXXPPSXXGAPP 326 P PPPP P P PA PPS PP Sbjct: 144 PTNPPPP--PESPPSLPAPDPPSNPLPPP 170 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/52 (28%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP-PPPRXPXPPXXPPPXAP 822 P + P P + P P P P P PP P PPP P Sbjct: 174 PPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHP 225 Score = 27.9 bits (59), Expect = 9.9 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 5/60 (8%) Frame = +1 Query: 667 PPXPXATPGXXX-GPXXGQRPXPXGXXPGXPPPXX---PPPPRXPXPPXX-PPPXAPXXP 831 PP P + P P P P P PP PP P PP P P A P Sbjct: 148 PPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERP 207 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 36.7 bits (81), Expect = 0.021 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P GP RP P PG P PPPP P P PPP Sbjct: 372 PPVPAPQMPSSAGPP---RPPPPAPPPGSGGPKPPPPP-GPKGPRPPPP 416 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 Q P G P PPP PP P PP P P P PP Sbjct: 378 QMPSSAGP-PRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 655 GXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP 798 G PP P PG GP P P G P P P PR P P Sbjct: 384 GPPRPPPPAPPPGSG-GPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G P P P PP PPR P P PPP PP Sbjct: 143 GSSPSPS---PSRPPKRSRGPPRPPTRPKSPPPRKSSFPP 179 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 688 PGXXXGPXXGQRPXPXGXXPGXPP--PXXPPPPRXPXPPXXPPPXAP 822 PG P RP P PP P PPP + PP PP P Sbjct: 142 PGSSPSPSPS-RPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPPP 187 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P ++ G P P G P PPP P PR P PP P AP P Sbjct: 377 PQMPSSAGPPRPPPPAPPPGSGGPKP--PPPPGPKGPR-PPPPMSLGPKAPRPP 427 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P PP P P PP P PP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 Score = 25.0 bits (52), Expect(2) = 6.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 415 GPXXPPPPXXPXXXPXGPAXXPPSXXG 335 GP PPPP P GP PP G Sbjct: 399 GPKPPPPPG-----PKGPRPPPPMSLG 420 Score = 21.8 bits (44), Expect(2) = 6.1 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -2 Query: 535 PPXXGXAPXPXPPP 494 PP P P PPP Sbjct: 393 PPPGSGGPKPPPPP 406 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 36.7 bits (81), Expect = 0.021 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P GP RP P PG P PPPP P P PPP Sbjct: 372 PPVPAPQMPSSAGPP---RPPPPAPPPGSGGPKPPPPP-GPKGPRPPPP 416 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 Q P G P PPP PP P PP P P P PP Sbjct: 378 QMPSSAGP-PRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 655 GXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP 798 G PP P PG GP P P G P P P PR P P Sbjct: 384 GPPRPPPPAPPPGSG-GPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G P P P PP PPR P P PPP PP Sbjct: 143 GSSPSPS---PSRPPKRSRGPPRPPTRPKSPPPRKSSFPP 179 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 688 PGXXXGPXXGQRPXPXGXXPGXPP--PXXPPPPRXPXPPXXPPPXAP 822 PG P RP P PP P PPP + PP PP P Sbjct: 142 PGSSPSPSPS-RPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPPP 187 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P ++ G P P G P PPP P PR P PP P AP P Sbjct: 377 PQMPSSAGPPRPPPPAPPPGSGGPKP--PPPPGPKGPR-PPPPMSLGPKAPRPP 427 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P PP P P PP P PP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 Score = 25.0 bits (52), Expect(2) = 6.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 415 GPXXPPPPXXPXXXPXGPAXXPPSXXG 335 GP PPPP P GP PP G Sbjct: 399 GPKPPPPPG-----PKGPRPPPPMSLG 420 Score = 21.8 bits (44), Expect(2) = 6.1 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -2 Query: 535 PPXXGXAPXPXPPP 494 PP P P PPP Sbjct: 393 PPPGSGGPKPPPPP 406 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP + P P P P P PPP P P P P P P P PP Sbjct: 27 PPSHISPPPPPFSPPH-HPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPP 81 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-XPXPPXXPPP 813 PP P +P P P P P P PPPP P PP P P Sbjct: 44 PPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTPAP 93 Score = 33.9 bits (74), Expect = 0.15 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPX--APXXPP 834 PP P +P P P P P P PPP P P PPP P PP Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPPSP-YPHPHPPPPSPYPHPHQPPPPPHVLPPPPP 89 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P +P P P P PPP PP P PP PP P P Sbjct: 9 PYYSPPSHQHPLPSPVPPPPSHISPPPPPF--SPPHHPPPPHFSPPHQPPPSP 59 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/60 (33%), Positives = 22/60 (36%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXG---QRPXPXGXXPGXPPPXX-PPPPRXPXPPXXPPPXAPXXPP 834 PP P + P P Q P P PPP P P + P PP PP P P Sbjct: 34 PPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTPAP 93 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P P P PPP P P PPP +P P Sbjct: 21 PSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPP-SPYPHPHPPPPSPYPHP 74 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 36.7 bits (81), Expect = 0.021 Identities = 24/60 (40%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Frame = -1 Query: 833 GGXXGAXG-GGXXGGXGXRGGGGXXGGG---XPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G+ G GG GG G GGGG GGG G G G + G G G GG Sbjct: 346 GGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGG 405 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 305 NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGG 400 N G GGG G GGG G GG G GGG Sbjct: 307 NRGGYSMGGG-GGYGGGPGDMYGGSYGEPGGG 337 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG GGG GG G GG GGG G G G Sbjct: 230 GGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYG 266 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 G GA GGG GG GGGG G G G Sbjct: 386 GGYGAGGGGNGGGSFYGGGGGRGGYGGGG 414 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXG 705 G G GGG G GGGG GGG PG G P G Sbjct: 297 GRYGGGGGGYNRGGYSMGGGGGYGGG-PGDMYGGSYGEPGGG 337 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGG---GXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG G G GGG GG G G G + G GV G G Sbjct: 328 GGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAG 386 Score = 30.7 bits (66), Expect = 1.4 Identities = 26/77 (33%), Positives = 28/77 (36%), Gaps = 1/77 (1%) Frame = +1 Query: 310 SGXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRXX 489 SG G GGG GG G G G GGGG G R P ++ R Sbjct: 253 SGGGYGGGRSGGYGGYG----GEFGGYGGGGYGG----GVGPYRGEPALGYSGRYGGGGG 304 Query: 490 XXG-GGXGXGXGXGXGG 537 GG G G G GG Sbjct: 305 GYNRGGYSMGGGGGYGG 321 Score = 29.9 bits (64), Expect = 2.5 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGG--GXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG GG G GG G GGG G G + G G G GG Sbjct: 309 GGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGG 366 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXG---GGXPGXXPXGXG 723 G G GGG GG G GGG G GG G G G Sbjct: 374 GYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGG 413 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G G GG GGGG G Sbjct: 378 GGVGGGGAGGYGAGGGGNGGG--SFYGGGGGRG 408 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GG GG G RGG G G G Sbjct: 391 GGGGNGGGSFYGGGGGRGGYGGGGSG 416 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGG--GGAXG 411 G G GGGP GG +P G G G GG G Sbjct: 316 GGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYG 350 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXG 705 G GA G G GG G GGG G G GR+ G Sbjct: 381 GGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSGRYHPYG 422 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 G G G GGG GG G GGGG Sbjct: 389 GAGGGGNGGGSFYGGGGGRGGYGGGG 414 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GGG G G GGG G G P G G G G G GG Sbjct: 229 GGGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGG 277 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGG-XXGXXGGGGXXG 412 GGG G GGG GG G GGGG G Sbjct: 358 GGGMGGAGGGGYRGGGGYDMGGVGGGGAGG 387 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXP-GXXPXGXGRWPXXGP 702 G GG GG G GGGG GG P G P G G GP Sbjct: 379 GPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGGP 419 Score = 33.5 bits (73), Expect = 0.20 Identities = 28/91 (30%), Positives = 33/91 (36%), Gaps = 11/91 (12%) Frame = +1 Query: 289 PXXXVKXSGXGXGGGPPXXRGGX--GXDPXGXXGXXGG---------GGAXGXPKRXPPE 435 P K G G GGG GG G P G G GG GGA G P P+ Sbjct: 380 PNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGGPQSMSMPMGGAMGGPMGSLPQ 439 Query: 436 XRXAPPXPFTPRLRSRXXXXGGGXGXGXGXG 528 P P + +++ G G G G G Sbjct: 440 -MGGGPGPMSNNMQAVQGLPAMGPGGGGGGG 469 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKR 423 G G GGGP G G G GGGG G P + Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPPK 142 Score = 32.3 bits (70), Expect = 0.46 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 5/57 (8%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXP--GXXPXGXGRWPXXGPX---LXPGVAXGXGG 666 G GGG G G +GGGG G P G G G GP L PG GG Sbjct: 356 GKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGG 412 Score = 32.3 bits (70), Expect = 0.46 Identities = 37/146 (25%), Positives = 38/146 (26%) Frame = +1 Query: 319 GXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRXXXXG 498 G GGGP +GG G G GG G P PP F P G Sbjct: 360 GGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPG-FRP---MGGGGGG 415 Query: 499 GGXGXGXGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXAPXGGGGXXXPPXP 678 GG GG A P GGGG P Sbjct: 416 GGGPQSMSMPMGGAMGGPMGSLPQMGGGPGPMSNNMQAVQGLPA-MGPGGGGGGG--PSA 472 Query: 679 XATPGXXXGPXXGQRPXPXGXXPGXP 756 A PG G G PG P Sbjct: 473 EAPPGYFQGQVSGNGGGGQDSMPGNP 498 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXGXP 418 GGP G GG G G G GG G G P Sbjct: 324 GGPGGGGGNMGNQNQGGGGKNGGKGGGGHP 353 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP 654 GG G GGG G GGGG G G P G G G GG Sbjct: 341 GGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSG 400 Query: 653 PPPXG 639 P G Sbjct: 401 GLPPG 405 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 291 PXPXKTKRXXKXGGAPXXEGGXXAGPXGXXXGXXGGGGXXGPQ 419 P P K K P GG GP G G GGGG G Q Sbjct: 294 PGPAGGKIEGKGMPFPVQMGGGGGGPGGKKGGPGGGGGNMGNQ 336 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G + GGG GG G GG G GGGG Sbjct: 367 GNKGGGGVQMNGGPNGGKKGGGGGGGGGGG 396 Score = 29.9 bits (64), Expect = 2.5 Identities = 23/66 (34%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXG-GXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXX 657 GG G GGG G +GGGG GG G P G+ G P G GG Sbjct: 320 GGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPL-DGKMGGGGG--GPNGNKGGGGVQM 376 Query: 656 PPPPXG 639 P G Sbjct: 377 NGGPNG 382 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +2 Query: 326 GGGPXGXGGGXGXTX-GGXXGXXGGGGXXG 412 GGGP G GG G GG G GGG G Sbjct: 362 GGGPNGNKGGGGVQMNGGPNGGKKGGGGGG 391 Score = 29.9 bits (64), Expect = 2.5 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 2/67 (2%) Frame = -1 Query: 833 GGXXGAXGGGXXG-GXGXRGGG-GXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXX 660 GG G GGG G GG G GGG G P G P P G G GG Sbjct: 363 GGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRP--MGGGGGGGGGPQ 420 Query: 659 XPPPPXG 639 P G Sbjct: 421 SMSMPMG 427 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/75 (29%), Positives = 24/75 (32%), Gaps = 2/75 (2%) Frame = +1 Query: 319 GXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPP--XPFTPRLRSRXXX 492 G GGP G G G G GG G G P P ++ Sbjct: 321 GKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGP 380 Query: 493 XGGGXGXGXGXGXGG 537 GG G G G G GG Sbjct: 381 NGGKKGGGGGGGGGG 395 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 10/39 (25%) Frame = -1 Query: 833 GGXXGAXGGGXX----------GGXGXRGGGGXXGGGXP 747 GG G GGG GG G GGGG GGG P Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 796 GGXGXGGGGGXXGGG 752 GG G GGGGG GGG Sbjct: 123 GGGGGGGGGGGGGGG 137 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 796 GGXGXGGGGGXXGGG 752 GG G GGGGG GGG Sbjct: 124 GGGGGGGGGGGGGGG 138 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 796 GGXGXGGGGGXXGGG 752 GG G GGGGG GGG Sbjct: 125 GGGGGGGGGGGGGGG 139 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXP--GVAXGXGG 666 GGG G G +GG G GG G G+ G P G G GG Sbjct: 313 GGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGG 363 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 10/41 (24%) Frame = +2 Query: 329 GGPXGXGGGXGXT----------XGGXXGXXGGGGXXGXPK 421 GG G GGG G GG G GGGG G PK Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPPK 142 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 305 NXAGXEXGGGPXGXGGGXGXTXGG 376 N G + GGG G GGG G GG Sbjct: 116 NNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXG--XXGGGGXXG 412 GGGP G GG G GG G GGGG G Sbjct: 316 GGGPGGKKGGPGG-GGGNMGNQNQGGGGKNG 345 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 787 GXGGGGGXXGGGXRGXXP 734 G GGGGG GGG G P Sbjct: 123 GGGGGGGGGGGGGGGGGP 140 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 793 GXGXGGGGGXXGGGXRG 743 G G GGGGG GGG G Sbjct: 123 GGGGGGGGGGGGGGGGG 139 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 787 GXGGGGGXXGGGXRGXXP 734 G GGGGG GGG G P Sbjct: 124 GGGGGGGGGGGGGGGGPP 141 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGG 400 + GGG G GG G G G GGG Sbjct: 338 QGGGGKNGGKGGGGHPLDGKMGGGGGG 364 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 36.7 bits (81), Expect = 0.021 Identities = 25/69 (36%), Positives = 27/69 (39%), Gaps = 9/69 (13%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXG----GGXPGXXPXGXGRWPXXG-----PXLXPGVA 681 GG G GG GG G GG G GG PG P G G G P + G+ Sbjct: 299 GGFPGGMPGGFPGGMGGMPGGFPGGMGGMGGMPGGFPGGMGGGMPAGMGGGMPGMGGGMP 358 Query: 680 XGXGGXXXP 654 G GG P Sbjct: 359 AGMGGGGMP 367 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG P G GGG GG GGGG G Sbjct: 336 GGMGGGMPAGMGGGMPGMGGGMPAGMGGGGMPG 368 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 319 GXGGGPPXXRGGXGXDPXGXXGXXGGGGAXG 411 G GGG P GG G P G GGGG G Sbjct: 352 GMGGGMPAGMGGGGM-PGAGGGMPGGGGMPG 381 Score = 29.1 bits (62), Expect = 4.3 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = -1 Query: 833 GGXXGAXGG--GXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXX 660 GG G GG G GG GGG G G G G G PG G G Sbjct: 318 GGFPGGMGGMGGMPGGFPGGMGGGMPAGMGGGMPGMGGGMPAGMGGGGMPGAGGGMPGGG 377 Query: 659 XPP 651 P Sbjct: 378 GMP 380 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 319 GXGGGPPXXRGGXGXDPXGXXGXXGGGGAXG 411 G GG P GG G P G G GGG G Sbjct: 315 GMPGGFPGGMGGMGGMPGGFPGGMGGGMPAG 345 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -1 Query: 794 GXGXRGG-GGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GG G GG PG P G G P P G+ GG Sbjct: 290 GGGFPGGMPGGFPGGMPGGFPGGMGGMPGGFPGGMGGMGGMPGG 333 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 36.7 bits (81), Expect = 0.021 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXP 747 G GGG GG G GGGG GGG P Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGGPP 84 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GGG GG G GG G GGG G P G Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRG 86 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGG 756 G G GGG GG G RGGG GG Sbjct: 63 GGGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 809 GGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG GG G GGG GGG G P G Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGG 397 GGG G GGG G + GG G GG Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGG 82 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG G GGG G GG G GGG G Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRG 86 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXP 747 G GG GG G GGGG GG P Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGP 83 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GGG GG G GGG GG Sbjct: 61 GMGGGGGGGGGSGGGGGGRGGGPPRGG 87 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 36.7 bits (81), Expect = 0.021 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 5/60 (8%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP-----PPPRXPXPPXXPPPXAPXXPP 834 P P P P P P P PP P PPP P P PP P PP Sbjct: 138 PSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPPANPNAPP 197 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP TP P P PPP P P P P PP +P PP Sbjct: 105 PPEDSETPPAPPNESNDNNPPPSQDLQS-PPPSSPSPNVGPTNPESPPLQSPPAPP 159 Score = 28.3 bits (60), Expect = 7.5 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXP---PPXX--PPPPRXPXPPXXPPPXAPXXP 831 PP P A P P P P PP PPPP PP P P P Sbjct: 39 PPSPPADSSSTPPLSEPSTPPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPP--P 96 Query: 832 P 834 P Sbjct: 97 P 97 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -2 Query: 397 PPXXPXXXPXGPAXXPPSXXGAPP 326 P P P GPA PP+ APP Sbjct: 174 PTNPPPIQPSGPATSPPANPNAPP 197 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 36.3 bits (80), Expect = 0.028 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXP 831 PPP PPPPR P PPP P P Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPPP 34 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 682 ATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 ATP P P P PPP PPPP+ P P P P Sbjct: 2 ATPSKRRPPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG GG GG G R GGG GG G G G G G G G Sbjct: 108 GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGG 162 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 88 GSGGGGGHRG-GGGGGYRSGGGGGYSGGGGSYG 119 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG--XXPXGXGRW 717 GG GGG G G R GGG GGG G G G W Sbjct: 136 GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 176 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG GGG G GG G GGGG Sbjct: 145 GGSYGGGRREGGGGYGGGEGGGYGGSGGGG 174 Score = 33.1 bits (72), Expect = 0.26 Identities = 24/56 (42%), Positives = 25/56 (44%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG GGGG GGG G G GR G G + G GG Sbjct: 90 GGGGGHRGGGG-GGYRSGGGGGYSGGG--GSYGGGGGRREGGG-----GYSGGGGG 137 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGX-XGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG GG G GGGG G G GR G G G GG Sbjct: 114 GGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGR-REGGGGYGGGEGGGYGG 169 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG + GG G GGG G Sbjct: 123 GRREGGGGYSGGGGGYSSRGGGGGSYGGGRREG 155 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GG G GG GGGG G Sbjct: 101 GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG 133 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG G GGG GG G GGGG Sbjct: 110 GYSGGGGSYGGGGGRREGGGGYSG--GGGG 137 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GGG GGG G + GG G GGGG Sbjct: 99 GGGGYRSGGGGGYSGGG--GSYGGGG 122 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG GGG GG GGGG G Sbjct: 121 GGGRREGGGGYSGGGGGYSSRGGGGGSYG 149 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 788 GXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GGGG GGG G G G + G G GG Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGG 128 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG GG G GG GGGG Sbjct: 94 GHRGGGGGGYRSGGGGGYSGGGGSYGGGGG 123 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GG GGGG GG G G G + G G GG Sbjct: 88 GSGGGGGHRGGGGGGYRSGGG-GGYSGGGGSYGGGGGRREGGGGYSGGG 135 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +1 Query: 688 PGXXXGPXXGQRPXPXGXXP-GXPPPXXP-PPPRXPXPPXXPPPXAPXXP 831 PG P G P P G P G PPP PP P PP PP P Sbjct: 26 PGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGP 75 Score = 35.1 bits (77), Expect = 0.065 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 655 GXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 G PP A P P G P P G PP PPPP P P P P Sbjct: 27 GAYPPPPQGAYPPPGGYPPQGYPPPPHGY----PPAAYPPPPGAYPPAGYPGPSGP 78 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P G PPP PP P PP PP A PP Sbjct: 25 PPGAYPPPPQG---AYPPPGGYPPQGYPPPPHGYPPAAYPPPP 64 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 748 GXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G PP PPPP+ PP P PP Sbjct: 23 GYPPGAYPPPPQGAYPPPGGYPPQGYPPP 51 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 35.9 bits (79), Expect = 0.037 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXP--GXPPPXXPPPPRXPXPPXXPPPXAP 822 P P ATP P P P P P P PPP P P PP AP Sbjct: 26 PTPTATPPPATPPPVA-TPPPVATPPPAATPAPATPPPAATPAPATTPPSVAP 77 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXP 831 PPP PPP P P PPP A P Sbjct: 32 PPPATPPPVATPPPVATPPPAATPAP 57 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXP-GXPPPXXPPPPRXPXPPXXP--PPXAPXXP 831 P P ATP P P P P P P PP P P P P AP P Sbjct: 37 PPPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSPADVPTASPPAPEGP 93 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP PPP PP P AP PP Sbjct: 34 PATPPPVATPPPVATPPPAATP--APATPP 61 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P PPP P P PPP A P Sbjct: 26 PTPTATPPPATPPPVATPPPVATPPP 51 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P ATP P P P PP P P P P P P Sbjct: 43 PPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSPADVPTASPPAPEGPTVSP 97 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 Q P P P PP PPP PP PP A P Sbjct: 22 QAPAPT---PTATPPPATPPPVATPPPVATPPPAATPAP 57 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P G R P PPP PPPP PP PPP PP Sbjct: 283 PKPPPKRSISLGDSTENRADPPPQKSIPPPPPPPPPPLLQQPP--PPPSVSKAPP 335 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXX----PPPXAPXXPP 834 P P P PPP PP + P PP PPP P PP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR 783 PP P P P Q P P PPP PPPP+ Sbjct: 311 PPPPPPPP-----PLLQQPPPPPSVSKAPPPPPPPPPPK 344 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP 780 PP P P P Q+P P PPP PPPP Sbjct: 310 PPPPPPPP-----PPLLQQPPPPPSVSKAPPPPPPPPP 342 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 35.9 bits (79), Expect = 0.037 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXR-GGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GGG GG G GGGG G G G G G L P G G Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGGGLRPIPIYGGG 128 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 35.9 bits (79), Expect = 0.037 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGX-RGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GGG GG G R GGG GG G G G G G G G Sbjct: 90 GGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGG 145 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG--XXPXGXGRW 717 GG GGG G G R GGG GGG G G G W Sbjct: 119 GGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 159 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG GGG G GG G GGGG Sbjct: 128 GGSYGGGRREGGGGYGGGEGGGYGGSGGGG 157 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGX-XGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG GG G GGGG G G GR G G G GG Sbjct: 97 GGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGR-REGGGGYGGGEGGGYGG 152 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG + GG G GGG G Sbjct: 106 GRREGGGGYSGGGGGYSSRGGGGGSYGGGRREG 138 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG G GGG GG G GGGG Sbjct: 93 GGHRGGGSYGGGGGRREGGGGYSG--GGGG 120 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G+ GGG G G GGGG G G G G Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGG 120 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG GGG GG GGGG G Sbjct: 104 GGGRREGGGGYSGGGGGYSSRGGGGGSYG 132 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 818 AXGGGXXGGXGXRGGGGXXGGG 753 A G GG G RGGG GGG Sbjct: 84 AQSRGSGGGGGHRGGGSYGGGG 105 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GG GG G GGGG GGG G Sbjct: 785 GGCGGGHHGGGGGGCGGCGGGGCGGGGDGG 814 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +2 Query: 311 AGXEXGG--GPXGXGGGXGXTXGGXXGXXGGGGXXG 412 AG GG G G GGG GG G GGGG G Sbjct: 774 AGYHHGGHHGGGGCGGGHHGGGGGGCGGCGGGGCGG 809 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXG-GXGXRGGGGXXGG 756 GG G GGG G G G GGGG GG Sbjct: 789 GGHHGGGGGGCGGCGGGGCGGGGDGGG 815 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG GGGG G G G G G Sbjct: 779 GGHHG--GGGCGGGHHGGGGGGCGGCGGGGCGGGGDG 813 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG GG G GGGG G Sbjct: 784 GGGCGGGHHGGGGGGCGGCGG--GGCGGGGDGG 814 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -2 Query: 796 GGXGXGG-GGGXXGGGXRGXXPXXRAV 719 GG G GG GGG GGG G RAV Sbjct: 795 GGGGCGGCGGGGCGGGGDGGGMTSRAV 821 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 35.9 bits (79), Expect = 0.037 Identities = 24/61 (39%), Positives = 25/61 (40%), Gaps = 5/61 (8%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGG-----GXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG GGG GG G GG G GGG PG G G G + GV G G Sbjct: 124 GGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGG--IGGGGGIGGGVIIGGG 181 Query: 668 G 666 G Sbjct: 182 G 182 Score = 34.7 bits (76), Expect = 0.086 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG---RWPXXGPXLXPGVAXGXGG 666 GG G GGG G G GGG GGG G G G W PG G GG Sbjct: 109 GGGPGYGGGGYGPGGG--GGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGG 165 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGG---GXXGGGXPGXXPXGXG 723 GG GGG GG G GGG G GGG G G G Sbjct: 155 GGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGG 194 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 AG GGGP GGG G GG GGG G Sbjct: 104 AGGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGG 137 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG GGGG GG G G G Sbjct: 163 GGGIGG-GGGIGGGVIIGGGGGGCGGSCSGGGGGGGG 198 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG GGG GG GGGG G G G G G+ Sbjct: 174 GGVIIGGGGGGCGGSCSGGGGGGGGYGHGGVSTKGSGK 211 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 G G GGG G G GG G GG G G P G G+ G G Sbjct: 118 GYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSG-GGGIGGGGG 171 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXG 705 G G GGG GG GGGG GG G G + G Sbjct: 162 GGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGG 203 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G GG GGGG G Sbjct: 158 GYGSGGGGIGGGGGIG---GGVIIGGGGGGCGG 187 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 314 GXEXGGGPXGX---GGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G G G GGGG G Sbjct: 165 GIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYG 200 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 311 AGXEXGGGPX--GXGGGXGXTXGGXXGXXGGGGXXG 412 AG GGG G GG G G G GGGG G Sbjct: 138 AGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIG 173 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 341 GXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G G Sbjct: 133 GFGGGAGYGSGGGLGWDGGNGGGG 156 Score = 27.9 bits (59), Expect = 9.9 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GG G GGG GGG G P G G G G G GG Sbjct: 97 GFKGELTAGGYG--GGGPGYGGG--GYGPGGGGGGVVIGGGFGGGAGYGSGG 144 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG GGG G GG G G G G Sbjct: 116 GGGYGPGGGGGGVVIGGGFGGGAGYGSGG 144 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 35.5 bits (78), Expect = 0.049 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-PRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PP PPP + P P PPP PP Sbjct: 76 PPPPYEHPPVKYPPPIKTYPHPPVKYP--PPEQYPPPIKKYPPPEQYPPPIKKYPPP 130 Score = 34.7 bits (76), Expect = 0.086 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-PRXPXPPXXPPPXAPXXPP 834 PP P P Q P P P PP PPP + P P PPP PP Sbjct: 154 PPPEHYPPPIKKYPPQEQYPPPIKKYP--PPEKYPPPIKKYPPPEQYPPPIKKYPPP 208 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +1 Query: 667 PPXPXAT---PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 PP P T P P + P P P P PPP P PP P A Sbjct: 233 PPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPPPVEYPSPPYKKYPPA 286 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P Q P P PP PPP + PP PP PP Sbjct: 115 PPPEQYPPPIKKYPPPEQYSPPFKKYP--PPEQYPPPIKKYPPPEHYPPPIKKYPP 168 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-XPXPP--XXPPPXAPXXPP 834 PP P P + P P P P PPP + P PP PPP PP Sbjct: 200 PPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPP 258 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP PP + P P PPP PP Sbjct: 53 PPKPPPIEKYPPPVQYPPPIKKYPPP 78 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/56 (32%), Positives = 20/56 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P + P P P PP PPP + P P PP PP Sbjct: 70 PPIKKYPPPPYEHPPV-KYPPPIKTYP-HPPVKYPPPEQYPPPIKKYPPPEQYPPP 123 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P + P P P P PPP P P PP PP Sbjct: 122 PPIKKYPPPEQYSPPFKKYPPPEQYPP--PIKKYPPPEHYPPPIKKYPPQEQYPPP 175 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P + P P P PP PPP + PP P PP Sbjct: 167 PPQEQYPPPIKKYPPPEKYPPPIKKYP--PPEQYPPPIKKYPPPIKKYPPPEEYPP 220 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +1 Query: 688 PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP--RXPXPPXXPPP 813 P GP P PPP PPP + P PP PP Sbjct: 41 PPFKWGPKFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPP 84 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRW 717 G G GG GG G R GGG GGG G G G W Sbjct: 69 GSGGGGGGRGYGGGGRREGGGY-GGGDGGSYGGGGGGW 105 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGG 400 G GGG GGG G GG G GGG Sbjct: 76 GRGYGGGGRREGGGYGGGDGGSYGGGGGG 104 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGG--GGXXG 412 G GGG G GGG GG G GG GG G Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 103 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 35.5 bits (78), Expect = 0.049 Identities = 26/66 (39%), Positives = 27/66 (40%), Gaps = 7/66 (10%) Frame = +1 Query: 655 GXXXPPXPXATPGXXXGPXXGQRPX---PXGXXPGXPPP----XXPPPPRXPXPPXXPPP 813 G PP + P P GQRP P G G PPP PPPPR P P P Sbjct: 187 GMRPPPQQFSGPPP---PQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPR-PGMPPAPGG 242 Query: 814 XAPXXP 831 AP P Sbjct: 243 FAPPRP 248 Score = 32.7 bits (71), Expect = 0.35 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Frame = +1 Query: 655 GXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP----XAP 822 G PP P G G P P G P PPPP+ P PPP P Sbjct: 163 GQMLPPPPFGGQGPPMGRGP---PPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGP 219 Query: 823 XXPP 834 PP Sbjct: 220 PPPP 223 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = +1 Query: 649 GGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXX 828 G G P A PG GP G G PG P PP+ PP PP Sbjct: 113 GRGVPTGPLVQAQPGLS-GPVRGV----GGPAPGMMQPQISRPPQLSAPPIIRPPGQMLP 167 Query: 829 PP 834 PP Sbjct: 168 PP 169 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP 774 P GG PP P G P G P P G P P P PP Sbjct: 211 PPGGMMRGPPPPPHGMQGPPP-PRPGMPPAPGGFAP--PRPGMPP 252 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 35.5 bits (78), Expect = 0.049 Identities = 26/66 (39%), Positives = 27/66 (40%), Gaps = 7/66 (10%) Frame = +1 Query: 655 GXXXPPXPXATPGXXXGPXXGQRPX---PXGXXPGXPPP----XXPPPPRXPXPPXXPPP 813 G PP + P P GQRP P G G PPP PPPPR P P P Sbjct: 187 GMRPPPQQFSGPPP---PQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPR-PGMPPAPGG 242 Query: 814 XAPXXP 831 AP P Sbjct: 243 FAPPRP 248 Score = 32.7 bits (71), Expect = 0.35 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Frame = +1 Query: 655 GXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP----XAP 822 G PP P G G P P G P PPPP+ P PPP P Sbjct: 163 GQMLPPPPFGGQGPPMGRGP---PPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGP 219 Query: 823 XXPP 834 PP Sbjct: 220 PPPP 223 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = +1 Query: 649 GGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXX 828 G G P A PG GP G G PG P PP+ PP PP Sbjct: 113 GRGVPTGPLVQAQPGLS-GPVRGV----GGPAPGMMQPQISRPPQLSAPPIIRPPGQMLP 167 Query: 829 PP 834 PP Sbjct: 168 PP 169 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP 774 P GG PP P G P G P P G P P P PP Sbjct: 211 PPGGMMRGPPPPPHGMQGPPP-PRPGMPPAPGGFAP--PRPGMPP 252 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G GGG GG GGGG GGG G G G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXGXP 418 GG G GGG GG G GGGG G P Sbjct: 572 GGGGGGGGGGSDYYGG--GGYGGGGYGGAP 599 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GGG G GGG GG G G GG Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGG 597 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRW 717 GG G GG G G GGGG G G W Sbjct: 573 GGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAGVTSAW 611 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG GG G G G GGGG Sbjct: 64 GGASGGGYRNDGGRTGYGYGAGGGGGGGGG 93 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G GGG GG GGGG GGG G G G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXGXP 418 GG G GGG GG G GGGG G P Sbjct: 572 GGGGGGGGGGSDYYGG--GGYGGGGYGGAP 599 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GGG G GGG GG G G GG Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGG 597 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRW 717 GG G GG G G GGGG G G W Sbjct: 573 GGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAGVTSAW 611 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG GG G G G GGGG Sbjct: 64 GGASGGGYRNDGGRTGYGYGAGGGGGGGGG 93 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 35.5 bits (78), Expect = 0.049 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXP 831 PPP P PP+ P P PP AP P Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPP 97 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 736 GXXPGXPPPXXPPPPRXPXPPXXP-PPXAPXXPP 834 G P P P PP P P PP P PP PP Sbjct: 71 GPPPKPPEPPKPPEPEKPKPPPAPEPPKHVCKPP 104 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +3 Query: 702 RXRXXPTARXXGXXPRXPPPXXPPPPPXPXPP 797 + + P G P+ P P PP P P PP Sbjct: 60 KIKQKPVIISVGPPPKPPEPPKPPEPEKPKPP 91 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG GGG GG G GGGG GGG G Sbjct: 87 GGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 35.1 bits (77), Expect = 0.065 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG---XGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G G GG GGG G G G + G G G GG Sbjct: 45 GGHGGHGGGGHYGGGG-HGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGG 102 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG G GG GG G GGG GGG G G Sbjct: 82 GGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G GGG G GG G GGGG G Sbjct: 71 GHGLDGYGGGHGGHYGGGGGHYGGGGGHG 99 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GG G GG G GGG G Sbjct: 78 GGGHGGHYGGGGGHYGGGGGHGGGGHYGG 106 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXG--GGGXXG 412 G GGG GGG G GG G G GGG G Sbjct: 82 GGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 806 GXXGGXGXRGGGGXXGGGXPG 744 G GG G GGGG GGG G Sbjct: 42 GYHGGHGGHGGGGHYGGGGHG 62 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P + P P P PP P PP P P PPP P P Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTPP--PTPPSSPPPSITPPPSPPQPQP 101 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 5/66 (7%) Frame = +1 Query: 652 GGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP---PPRXPXPPXXPPP--X 816 GG P +P P P P PPP PP PP P PP PPP Sbjct: 36 GGSETTQPPATSPPSPPSPDTQTSPPPA--TAAQPPPNQPPNTTPP--PTPPSSPPPSIT 91 Query: 817 APXXPP 834 P PP Sbjct: 92 PPPSPP 97 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP A P P P P P PPP PPP P P PPP Sbjct: 61 PPATAAQPPPNQPPNTTPPPTP----PSSPPPSITPPPSPPQP--QPPP 103 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP--PPPRXPXPPXXPPPXAP 822 PP P P +P P PPP P PPP PP P P P Sbjct: 51 PPSPDTQTSPP--PATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPP 102 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/53 (32%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQ---RPXPXGXXPGXPPPXXP-PPPRXPXPPXXPPP 813 PP P ++P P +P P G P P P P+ P P PPP Sbjct: 79 PPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPP 131 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 28.3 bits (60), Expect(2) = 0.058 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 753 PPPXXPPPPPXP 788 PPP PPPPP P Sbjct: 282 PPPPPPPPPPLP 293 Score = 25.8 bits (54), Expect(2) = 0.058 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 768 PPPPPXPXPP 797 PPPPP P PP Sbjct: 329 PPPPPPPPPP 338 Score = 25.4 bits (53), Expect(2) = 3.0 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 745 PGXPPPXXPPPP 780 P PPP PPPP Sbjct: 280 PSPPPPPPPPPP 291 Score = 22.6 bits (46), Expect(2) = 3.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPP 813 PPP PPPP P PP Sbjct: 329 PPP--PPPPPPPVEYYKSPP 346 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 35.1 bits (77), Expect = 0.065 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 Query: 747 RXPPPXXPPPPPXPXPP 797 R PPP PPPPP P PP Sbjct: 23 RAPPPQPPPPPPPPPPP 39 Score = 33.5 bits (73), Expect = 0.20 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPPXAP 822 PP PPPP P PP PP P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPP 813 PPP PPPP P PP PPP Sbjct: 25 PPPQPPPPP--PPPPPPPPP 42 Score = 32.3 bits (70), Expect = 0.46 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 726 RXXGXXPRXPPPXXPPPPPXPXPP 797 R P+ PPP PPPPP P PP Sbjct: 21 RQRAPPPQPPPP--PPPPPPPPPP 42 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR 783 PP P P QR P P PPP PPPPR Sbjct: 8 PPPPPLPPRLEL---RRQRAPPPQPPPPPPPPPPPPPPR 43 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP PPPP P P P PP Sbjct: 26 PPQPPPPPPPPPPPPPPRLGPRLRLRLLPP 55 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 754 PPPXXPPP---PRXPXPPXXPPPXAPXXPP 834 PPP PP R PP PPP P PP Sbjct: 9 PPPPLPPRLELRRQRAPPPQPPPPPPPPPP 38 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 769 PPPPRXPXPPXXPPPXAPXXPP 834 PPP P PP PPP P P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPP 810 P PP PPPP P PP P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXP 794 P PPP PPPPP P Sbjct: 30 PPPPPPPPPPPPPRLGP 46 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPPP P Sbjct: 29 PPPPPPPPPPPPPPRLGP 46 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -1 Query: 833 GGXXG-AXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GGG GG G GGGG GGG G Sbjct: 145 GGSHGHGCGGGGGGGGGGLGGGGCGGGGCGG 175 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G + GG G G GGGG GGG G G G Sbjct: 137 GSASSCSGGGSHGHGCGGGGGGGGGGLGGGGCGGGG 172 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G G GGG G GG G GGGG G Sbjct: 145 GGSHGHGCGGGGGGGGGGLGG--GGCGGGGCGG 175 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -1 Query: 833 GGXXGAXGGGXXG-GXGXRGGGGXXGGGXPGXXPXGXG 723 G GGG G G G GGGG G G G G G Sbjct: 137 GSASSCSGGGSHGHGCGGGGGGGGGGLGGGGCGGGGCG 174 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 326 GGGPXGXG--GGXGXTXGGXXGXXGGGGXXG 412 GGG G G GG G GG G GGG G Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCGGGGCG 174 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G GG G GGGG G Sbjct: 79 GGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHG 111 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG G G GGGG GGG G G G + G G GG Sbjct: 60 GHGGHNGGGGHGLDGYGGGGGHYGGGG-GHYGGGGGHYGGGGGGYGGGGGHHGGG 113 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGV 684 GG GGG GG G GGG G G G G G PGV Sbjct: 78 GGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGGHGLNEPVQTKPGV 127 Score = 32.3 bits (70), Expect = 0.46 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGG--GXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG G G GGG G G G G G G G G G GG Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGG 105 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G G G GGGG G Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYG 83 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG GG G GGG G Sbjct: 74 GYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGG 106 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G GGG G GG GGGG G Sbjct: 69 GHGLDGYGGGGGHYGGGGGHYGGGGGHYG 97 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG GGG G GG G GGGG Sbjct: 86 GGHYGGGGGHYGGGGGG-YGGGGGHHGGGG 114 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GGG G G GGGG GG G G + G G GG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGG 92 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GGG G GG G G G GGGG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGG 69 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXG 385 G GGG G GGG G GG G Sbjct: 93 GGHYGGGGGGYGGGGGHHGGGGHG 116 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P Q P P PPP PPP P P P P PP Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPP 51 Score = 32.7 bits (71), Expect = 0.35 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P PPP PPPP PPP P Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 31.5 bits (68), Expect = 0.81 Identities = 23/78 (29%), Positives = 25/78 (32%), Gaps = 14/78 (17%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPP-------PXXP-------PP 777 P PP P + P P +P P PP P P PP Sbjct: 14 PPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPP 73 Query: 778 PRXPXPPXXPPPXAPXXP 831 P P PP PPP P P Sbjct: 74 P--PPPPSAPPPLVPDPP 89 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P GP Q P PPP PPP P PP P Sbjct: 48 PPPPPPHAYYQQGPHYPQFNQLQAPPP--PPPPSAPPPLVPDPPRHQGP 94 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PP PP PP PP P PP Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPP 35 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P PPPP PP PPP P Sbjct: 7 PYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQP 42 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG G GGGG G G G G G Sbjct: 101 GGGGGGYGGGTPGGGG--GGGGDTGAGAGGGGYGGGG 135 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 281 PPPPXXX*NXAGXEXGGGPXGXGGGXGXT-XGGXXGXXGGGGXXG 412 PP G GG P G GGG G T G G GGGG G Sbjct: 94 PPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTG 138 Score = 34.7 bits (76), Expect = 0.086 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG-XXPXGXGRW 717 GG G GGG GGGG GGG G G G+W Sbjct: 109 GGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSGQW 148 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GG GGGG GGG PG G G Sbjct: 84 GGYPPLYGTTPPGGGDVGGGGGGYGGGTPGGGGGGGG 120 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GGG GG G GGG GGG G G G Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAG 125 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG GGG GGG G G G Sbjct: 97 GGDVGGGGGGYGGGTP---GGGGGGGGDTGAGAGGGG 130 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 284 PPPXXX*NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 PP G + GGG G GGG GG G G G G Sbjct: 87 PPLYGTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGG 129 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G G G G GG G G GG G Sbjct: 114 GGGGGGGDTGAGAGGGGYGGG--GDTGAGGGVG 144 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G+ GGG GG G GGGG G G Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSGGG 215 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G GG GG G GG G GGG G G G Sbjct: 182 GSRYGGGGGSFGGGGG--GGAGSYGGGGAGAGSGGGG 216 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 326 GGGPXGXGGGXG-XTXGGXXGXXGGGGXXGXPK 421 GGG G GGG G + GG G GG G K Sbjct: 188 GGGSFGGGGGGGAGSYGGGGAGAGSGGGGGFSK 220 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G GG G GGGG G G G G G Sbjct: 179 GRQGSRYGGGGGSFGGGGGGGAGSYGGGGAGAG 211 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G G G G G G Sbjct: 182 GSRYGGGGGSFGGGGGGGAGSYGGGGAGAGSGG 214 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +2 Query: 311 AGXEXGGGPXG-XGGGXGXTXGGXXGXXGGGGXXGXP 418 AG GGG G GGG G GG G GGG G P Sbjct: 72 AGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLGGLP 108 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXP 747 GG G GGG GG G GG G GG P Sbjct: 80 GGGLGGGGGGLLGGGGFGGGAGGGLGGLP 108 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 AG G G G GGG G GG G GGGG G Sbjct: 66 AGIGAGAG-LGLGGGGGGLGGGGGGLLGGGGFGG 98 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWP 714 G G GG GG G GGG GGG G G G P Sbjct: 69 GAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLGGLP 108 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG G G G G GGGG GGG G G Sbjct: 60 GGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGG 94 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G G G G G G G GGGG G Sbjct: 52 GLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLG 84 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 33.5 bits (73), Expect = 0.20 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPPPP P PP Sbjct: 381 PPPSPPPPPPPPPPP 395 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/49 (34%), Positives = 21/49 (42%) Frame = -1 Query: 536 PPXPWPXPXPXPPPXXXXRDLSRGVXGXGGAXRXSGGXLLGXPXAPPPP 390 PP P P P P PPP + + G+ G S + P PPPP Sbjct: 382 PPSPPPPPPPPPPPLRSSQSVFYGLFKKG---VKSNKKIHSVPAPPPPP 427 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 753 PPPXXPPPPPXPXP 794 PPP PPPPP P P Sbjct: 296 PPPSPPPPPPPPPP 309 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 756 PPXXPPPPPXPXPP 797 PP PPPPP P PP Sbjct: 296 PPPSPPPPPPPPPP 309 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 744 PRXPPPXXPPPPPXP 788 P PPP PPPPP P Sbjct: 297 PPSPPPPPPPPPPQP 311 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 754 PPPXXPPPPRXPXPP 798 PPP PPPP P PP Sbjct: 381 PPPSPPPPPPPPPPP 395 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXP 794 P PP PPPPP P P Sbjct: 244 PPQQPPATPPPPPPPPP 260 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPP 810 P PPP PPPP P PP Sbjct: 297 PPSPPPPPPPPPPQPLIAATPP 318 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 744 PRXPPPXXPPPPP 782 P PPP PPPPP Sbjct: 383 PSPPPPPPPPPPP 395 Score = 27.5 bits (58), Expect(2) = 0.075 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 772 PPPRXPXPPXXPPP 813 PPP P PP PPP Sbjct: 296 PPPSPPPPPPPPPP 309 Score = 26.2 bits (55), Expect(2) = 0.075 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPP 780 P P PPP PPPP Sbjct: 244 PPQQPPATPPPPPPPPP 260 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG G GGG G G GGGG GG G G GR Sbjct: 48 GGRGGYGGGGGRGNRGG-GGGGYQGGDRGGRGSGGGGR 84 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXG--GGXPGXXPXG 729 G GA GGG GG G GGGG G GG G G Sbjct: 37 GGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGG 72 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG GGG G GG G G GG Sbjct: 52 GYGGGGGRGNRGGGGGGYQGGDRGGRGSGG 81 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXG-GXGXRGGGGXXGGGXPG 744 GG G GGG G G RGG G GGG G Sbjct: 56 GGGRGNRGGGGGGYQGGDRGGRGSGGGGRDG 86 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG GGG GG GG G GGG G Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYG 48 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 313 GXGXGGGPP--XXRGGXGXDPXGXXGXXGGGGAXG 411 G G GGG RG G G G GGGG G Sbjct: 26 GGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRG 60 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GGG G GG G GG G GGGG Sbjct: 43 GGGSYGGRGGYG--GGGGRGNRGGGG 66 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG G GGG G G GGGG GG G G GR Sbjct: 48 GGRGGYGGGGGRGNRGG-GGGGYQGGDRGGRGSGGGGR 84 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXG--GGXPGXXPXG 729 G GA GGG GG G GGGG G GG G G Sbjct: 37 GGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGG 72 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG GGG G GG G G GG Sbjct: 52 GYGGGGGRGNRGGGGGGYQGGDRGGRGSGG 81 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXG-GXGXRGGGGXXGGGXPG 744 GG G GGG G G RGG G GGG G Sbjct: 56 GGGRGNRGGGGGGYQGGDRGGRGSGGGGRDG 86 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG GGG GG GG G GGG G Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYG 48 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 313 GXGXGGGPP--XXRGGXGXDPXGXXGXXGGGGAXG 411 G G GGG RG G G G GGGG G Sbjct: 26 GGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRG 60 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GGG G GG G GG G GGGG Sbjct: 43 GGGSYGGRGGYG--GGGGRGNRGGGG 66 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 34.7 bits (76), Expect = 0.086 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXAT-PGXXXGPXX-GQRPXPXGXXPG--XPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P T P P G+ P P G P P P P P PP PPP PP Sbjct: 125 PPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPP--PPPATSASPP 182 Score = 33.9 bits (74), Expect = 0.15 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP-----XXPPPXAPXXP 831 P P A P P Q P P PP PPP PP PPP P Sbjct: 29 PTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSP 88 Query: 832 P 834 P Sbjct: 89 P 89 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP-PXXPPPXAPXXPP 834 PP P A+P P P PG P P P P P P P PP Sbjct: 116 PPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPP 172 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P +P P P P PPP PPP P PP A PP Sbjct: 37 PVTPPPSPPQSPPPVVSSSPPPP--VVSSPPPSSSPPPSPPVITSPPPTVASSPPP 90 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP---XXPPPPRXPXPPXXPPPXAPXXP 831 PP P +P G+ P P P P P PPPP P PP P P Sbjct: 134 PPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPP--PATSASPPSSNPTDP 189 Score = 32.3 bits (70), Expect = 0.46 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 6/62 (9%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXX-PGXPPPXXPPP--PRXPXP---PXXPPPXAPXX 828 PP P +P P P PPP PPP P+ P P PPP Sbjct: 5 PPLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSP 64 Query: 829 PP 834 PP Sbjct: 65 PP 66 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXG----PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P P P PP PPP P PPP PP Sbjct: 41 PPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSP--PPPVVIASPP 98 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/55 (27%), Positives = 16/55 (29%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP P P P PPP P P P PP +P P Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPP 142 Score = 29.5 bits (63), Expect = 3.2 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX--PPPPRXPXPP--XXPPPXAPXXPP 834 P P TP P P P P P P PPP P PP PP PP Sbjct: 99 PSTPATTPPAP--PQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPP 156 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP---XXPPPXAPXXP 831 PP P T P P P P PP P PP PP +P P Sbjct: 106 PPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTP 163 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 1/66 (1%) Frame = +1 Query: 640 PXGGGGXXXPPXPX-ATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPX 816 P G PP P +TP P P P PP P P PP P P Sbjct: 146 PSPPGETPSPPKPSPSTPT----PTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLPV 201 Query: 817 APXXPP 834 P P Sbjct: 202 VPREKP 207 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/57 (29%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXP--XPPXXPPPXAPXXPP 834 P P ++P P P P P PPP P PP P +P PP Sbjct: 64 PPPSSSPPPSP-PVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPP 119 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 34.7 bits (76), Expect = 0.086 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP-PXAPXXPP 834 PP P P P P P P P P P P P P PP P P PP Sbjct: 334 PPLPVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIPGIPP 390 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPP-PXAPXXP 831 P P P P PP P P PP PP P P P Sbjct: 274 PNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPP 308 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +1 Query: 745 PGXPP-PXXPPPPRXPXPPXXPPPXAPXXPP 834 P PP P P PP P P P P P PP Sbjct: 296 PSLPPIPLIPTPPTLPTIPLLPTPPTPTLPP 326 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 736 GXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G P P P PPP + P P P P P PP Sbjct: 175 GSKPLLPDPSFPPPLQDP-PNPSPLPNLPIVPP 206 Score = 28.7 bits (61), Expect = 5.7 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = +1 Query: 667 PPXPXATPGXXX-GPXXGQRPXPX-GXXPGXP-PPXXPPPPRXPXPPXXPP-PXAPXXP 831 PP P P P P P P P PP PP P P PP P P P P Sbjct: 262 PPNPLNPPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPP 320 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +1 Query: 730 PXGXXPGXPP----PXXPPPPRXPXPPXXPPPXAPXXPP 834 P P PP P PP P P P PP P PP Sbjct: 317 PTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPP 355 Score = 25.8 bits (54), Expect(2) = 1.8 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 2/40 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP--PP 780 PP P P P P P P P P PP PP Sbjct: 192 PPNPSPLPNLPIVPPLPNLPVPKLPVPDLPLPLVPPLLPP 231 Score = 23.0 bits (47), Expect(2) = 1.8 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP PP P P P P PP Sbjct: 262 PPNPLNPPSIIPPNPLIPSIPTPTLPP 288 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GGG GG G GGGG GGG Sbjct: 126 GYSYGGGGGGYGGGGGGYGGGGDGGGG 152 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 281 PPPPXXX*NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGG 400 P P G GGG G GGG G GG G GGG Sbjct: 115 PSAPRAYGGGGGYSYGGGGGGYGGGGGGYGGG--GDGGGG 152 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GG GG G GGGG GGG G Sbjct: 122 GGGGGYSYGGGGGGYGG-GGGGYGGGGDGG 150 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG GGG G GG G GGG G Sbjct: 123 GGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG GGG GG G GGG GGG Sbjct: 125 GGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 335 PXGXGGGXGXTXGGXXGXXGGGG 403 P GGG G + GG G GGGG Sbjct: 118 PRAYGGGGGYSYGGGGGGYGGGG 140 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 818 AXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 A GGG GG GGGG GGG G G G Sbjct: 120 AYGGG--GGYSYGGGGGGYGGGGGGYGGGGDG 149 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 796 GGXGXGGGGGXXGGGXRG 743 GG G GGGGG GGG G Sbjct: 132 GGGGYGGGGGGYGGGGDG 149 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 34.7 bits (76), Expect = 0.086 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +2 Query: 245 RGLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 R L+ N GPP PP G GG GGG G GG G GGG Sbjct: 168 RPLRVNAGPP---PPKREESFSRGPRSGGYGSERGGGYGSERGGGYGSERGGG 217 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 34.7 bits (76), Expect = 0.086 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +2 Query: 245 RGLKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 R L+ N GPP PP G GG GGG G GG G GGG Sbjct: 168 RPLRVNAGPP---PPKREESFSRGPRSGGYGSERGGGYGSERGGGYGSERGGG 217 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGX-GGGXGXTXGGXXGXXGGGGXXG 412 G E GGG GGG G GG G GG G Sbjct: 203 GSERGGGYGSERGGGYGSERGGGYGSQRSGGGYG 236 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 34.7 bits (76), Expect = 0.086 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXG 705 GG G GG GG G GGGG GGG G G G W G Sbjct: 35 GGAGGGEWGGAEGG-GAWGGGG-GGGGAWGGEGEGGGEWGGGG 75 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGG---XXGXXGGGGXXG 412 G GGG G GGG G GG G GGGG G Sbjct: 43 GGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGG 78 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG GA GG GG G GGGG GGG Sbjct: 55 GGGGGAWGGEGEGG-GEWGGGGEGGGG 80 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GGG G GGG GGG G Sbjct: 48 GGAWGGGGGGGGAWGGEGEGGGEWGGGGEG 77 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GG G GG GGG G G G W G G GG Sbjct: 27 GYEGEEEWGGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGG 78 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXG 411 G G GGG G G G G GGGG G Sbjct: 52 GGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 833 GGXXGAXGG-GXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GG G GG G GGG GGG G G G Sbjct: 93 GGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRG 130 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXGGX-GXRGGGGXXGGG 753 GG G GGG GG G RG GG GGG Sbjct: 106 GGRGGGRGGGSYGGGYGGRGSGGRGGGG 133 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPG 744 GGG GG G GGGG GGG G Sbjct: 92 GGGSSGGRGGFGGGGGRGGGRGG 114 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GGG G G GGGG GGG Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGGGGG 179 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GGG GGG G G G GGGG Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGGGGG 179 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 305 NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGG 400 N G GG G GGG G G G GGG Sbjct: 89 NSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGG 120 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G GGG G Sbjct: 88 GNSGGGGSSGGRGGFGG-GGGRGGGRGGGSYGG 119 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGG 400 + GGG G GGG GG G GGG Sbjct: 153 QGGGGYSGGGGGGRYGSGGGGGGGGGG 179 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGG 756 GG G GGG G G GGGG GG Sbjct: 156 GGYSGGGGGGRYGSGG--GGGGGGGG 179 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG GG G + GG G G GG G Sbjct: 103 GGGGGRGGGRGGGSYGGGYGGRGSGGRGG 131 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G P G G + GG G GGGG G Sbjct: 83 GAPVQGNSGGGGSSGGRGGFGGGGGRGG 110 Score = 28.7 bits (61), Expect = 5.7 Identities = 23/75 (30%), Positives = 24/75 (32%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPFTPRLRSRXXX 492 G G GGG RGG G G G GG G P + Sbjct: 101 GFGGGGGRGGGRGGGSY--GGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGGY 158 Query: 493 XGGGXGXGXGXGXGG 537 GGG G G G GG Sbjct: 159 SGGGGGGRYGSGGGG 173 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 796 GGXGXGGGGGXXGGGXRGXXPXXRAVG 716 GG G G GGG GGG G R G Sbjct: 106 GGRGGGRGGGSYGGGYGGRGSGGRGGG 132 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG + G G GG G RGGG GG G Sbjct: 91 GGGGSSGGRGGFGGGGGRGGG-RGGGSYGG 119 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 G G GGG G G GGGG GGG G Sbjct: 53 GGGGYNGGGGHNGGGYNGGGGYNGGGHGG 81 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG G GGG G G GGG GGG Sbjct: 46 GGNGGYNGGGGYNGGGGHNGGGYNGGG 72 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GG GG G GGGG GGG G Sbjct: 43 GGHGG--NGGYNGGGGYNGGGGHNGGGYNG 70 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG G GGG GG G GGG GGG G G Sbjct: 49 GGYNG--GGGYNGGGGHNGGGYNGGGGYNGGGHGG 81 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGG 400 G GGG G GG G G G GGG Sbjct: 50 GYNGGGGYNGGGGHNGGGYNGGGGYNGGG 78 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -1 Query: 809 GGXXGGXGXRGGGG-XXGGGXPGXXPXGXGRWPXXG 705 GG G G GGGG GGG G G G + G Sbjct: 43 GGHGGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGG 78 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 34.7 bits (76), Expect = 0.086 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PPP PPP P PPP P PP Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPP 118 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAP 822 P PPP PPPP PP PP P Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPP 118 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 5/35 (14%) Frame = +1 Query: 724 PXPXGXXPGXPPPXX--PPPPRXPXPP---XXPPP 813 P P P PPP PPPP P PP PPP Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPP 126 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP PPPP PP Sbjct: 93 PPSPPPPSPPPPSQACPP 110 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GGG GG G GGG GG G G G A G GG Sbjct: 126 GGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGG 181 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 G GGG GG G GG G GGG G G Sbjct: 124 GFGGGGYGGGGGGYGGSGGYGGGAGGYGGSG 154 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 833 GGXXGAXG-GGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G G GG GG G GG G GG G G G Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGG 159 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G G GG G Sbjct: 129 GYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAG 161 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 +G GGG G GGG GG G GG G G Sbjct: 121 SGGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSG 154 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G + G G G GG G Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGG 155 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = -1 Query: 833 GGXXGAXG-GGXXGGXGXRGGGGXXG---GGXPGXXPXGXG 723 GG G+ G GG GG G GGG G GG G G G Sbjct: 148 GGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYG 188 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GGG GG GGGG G G G G G G G A G GG Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYG-----GSGGYGGGAGGYGG 165 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 305 NXAGXEXGGGPXGXG--GGXGXTXGGXXGXXGGGGXXG 412 N A GG G G GG G GG G GG G G Sbjct: 114 NYANDRTSGGGFGGGGYGGGGGGYGGSGGYGGGAGGYG 151 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GG G GG G G GG G Sbjct: 127 GGGYGGGGGGYGGSGGY-GGGAGGYGGSGGYGG 158 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGG 400 G G G G GG G GG G GGG Sbjct: 142 GYGGGAGGYGGSGGYGGGAGGYGGNSGGG 170 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G GG GG G G GG GG G G G Sbjct: 165 GNSGGGYGGNAAGGYGGSGAGG-YGGDATGHGGAGGG 200 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GG G GG G GG G Sbjct: 149 GYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGG 181 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXG-GXXGXXGGGGXXG 412 GGG G GG G G G G GGG G Sbjct: 144 GGGAGGYGGSGGYGGGAGGYGGNSGGGYGG 173 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXX-GXXGGGGXXG 412 GGG G GG G GG G GG G G Sbjct: 157 GGGAGGYGGNSGGGYGGNAAGGYGGSGAGG 186 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P PPP PPPP P PPP P Sbjct: 42 PCSPVQSSPPPPSPPPPSTPTTACPPPPSPP 72 >At3g46270.1 68416.m05008 receptor protein kinase-related contains weak similarity to light repressible receptor protein kinase (GI:1321686) [Arabidopsis thaliana] Length = 470 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGG 756 GG G GGG GG G + GGG GG Sbjct: 360 GGSGGKSGGGDNGGGGGQSGGGNNGG 385 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 809 GGXXGGXGXRGGGGXXGGGXPG 744 GG GG GGGG GGG G Sbjct: 363 GGKSGGGDNGGGGGQSGGGNNG 384 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -1 Query: 833 GGXXGAXGGG---XXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG G GGG GG G GGGG GGG G G GR Sbjct: 41 GGGFGDNGGGRYQGGGGHGGHGGGGYQGGG--GRYQGGGGR 79 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/28 (57%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXG-XRGGGGXXGGG 753 GG G GGG GG G +GGGG GGG Sbjct: 56 GGHGGHGGGGYQGGGGRYQGGGGRQGGG 83 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 E GG G GG GG G GGGG G Sbjct: 38 EQHGGGFGDNGGGRYQGGGGHGGHGGGGYQG 68 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 305 NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 N G GGG G GG G GG GGGG G Sbjct: 47 NGGGRYQGGGGHGGHGGGGYQGGGGR-YQGGGGRQG 81 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXG 705 GG G G GGG GG G G GR+ G Sbjct: 42 GGFGDNGGGRYQGGGGHGGHGGGGYQGGGGRYQGGG 77 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 + GGG GGG G GG G GGGG Sbjct: 46 DNGGGRYQGGGGHGGHGGG--GYQGGGG 71 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXP--PPPRXPX-PPXXPPPXAPXXPP 834 P P P P PP P PP + P PP PP AP PP Sbjct: 58 PHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPP 103 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PP PP PP PP AP PP Sbjct: 106 PPVKPPVSPPAKPPVKPPVYPPTKAPVKPP 135 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PP PP PP PP AP PP Sbjct: 178 PPVKPPVSPPAKPPVKPPVYPPTKAPVKPP 207 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 730 PXGXXPGXPPPXXP--PPPRXPX-PPXXPPPXAPXXPP 834 P P PP P PP + P PP PP AP PP Sbjct: 118 PPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPP 155 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 730 PXGXXPGXPPPXXP--PPPRXPX-PPXXPPPXAPXXPP 834 P P PP P PP + P PP PP AP PP Sbjct: 138 PPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPP 175 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PP PP PP PP P PP Sbjct: 190 PPVKPPVYPPTKAPVKPPVSPPTKPPVTPP 219 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PP PP PP PP P PP Sbjct: 86 PPVKPPVYPPTKAPVKPPTKPPVKPPVSPP 115 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PP PP PP PP P PP Sbjct: 158 PPVKPPVYPPTKAPVKPPTKPPVKPPVSPP 187 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 730 PXGXXPGXPPPXXP--PPPRXPX-PPXXPPPXAPXXPP 834 P P PP P PP + P PP PP P PP Sbjct: 86 PPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPP 123 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 730 PXGXXPGXPPPXXP--PPPRXPX-PPXXPPPXAPXXPP 834 P P PP P PP + P PP PP P PP Sbjct: 158 PPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPP 195 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 33.9 bits (74), Expect = 0.15 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQR-PXPXGXXPGXPPP--XXPPPPRXP--XPPXXPPPXAPXXP 831 PP P P G P P G G PPP PPP P PP P AP P Sbjct: 181 PPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPPPSRPGMPPPGGAPMFAPPHP 240 Score = 28.7 bits (61), Expect = 5.7 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +1 Query: 649 GGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 G G P A PG GP G G PG P PP+ PP PP P Sbjct: 114 GRGVPTGPLVQAQPGLS-GPVRGI----GGPAPGMMQPQISRPPQIIRPPGQMPPQPP 166 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 9/65 (13%) Frame = +1 Query: 667 PPXPXATPGXXX----GPXXGQRPXPXGXXPGXPPPXXPP---PPRXPX--PPXXPPPXA 819 P P TPG P P P PP PP PPR P PP PPP Sbjct: 117 PLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGI 176 Query: 820 PXXPP 834 PP Sbjct: 177 DPPPP 181 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P GP P P P P P P P PP PP P P Sbjct: 116 PPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFP 168 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P Q P P P P P P P P P P P P Sbjct: 105 PPEVTTVPSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEP 160 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPP---PRXPXPPXXPPP 813 + P P PPP PP P P PP PP Sbjct: 103 ETPPEVTTVPSDPPPLGPPQTPGPEFPVPPSPSPP 137 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP 807 PP P P P + P P P PP PPP P PP P Sbjct: 144 PPTPKTPPDVV--PPIWEPPRP----PDIFPPESPPPGIDPPPPLGP 184 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 E GG G GG G GG G GGGG G Sbjct: 9 EISGGAGGGGGHGGGAGGGFGGGAGGGGGHG 39 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -1 Query: 821 GAXGGGXXGGXGXRG-GGGXXGGGXPG 744 GA GGG GG G GGG GGG G Sbjct: 13 GAGGGGGHGGGAGGGFGGGAGGGGGHG 39 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGG 756 G G GGG GG G GGG G Sbjct: 15 GGGGGHGGGAGGGFGGGAGGGGGHG 39 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRW 717 GG GG GG G GGGG GG G G GR+ Sbjct: 8 GGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGGGGRF 46 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXG 705 GGG G G GGGG GG G G GR+ G Sbjct: 8 GGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGGG 43 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G GG GGGG G Sbjct: 15 GGRDGGGGGRFGGGGGRFGGGGGRFGGGGGRFG 47 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPG 744 GGG GG G GGGG GGG G Sbjct: 14 GGGGCGGGGSSGGGGSSGGGGGG 36 Score = 32.3 bits (70), Expect = 0.46 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGG 768 GG G GGG GG G GGGG Sbjct: 13 GGGGGCGGGGSSGGGGSSGGGG 34 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXGXPK 421 GGG G GGG G + GG GGGG G K Sbjct: 12 GGGGGGCGGG-GSSGGGGSSGGGGGGPCGACK 42 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GGG G G GGG GGG G Sbjct: 12 GGGGGGCGGGGSSGGGGSSGGG--GGGPCG 39 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 GQ P P P PP P P P P PP PP Sbjct: 144 GQPPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPP 183 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P + P P P P PP P P P PP P Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP 780 PP P + P P + P P P P PPPP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPP 183 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 688 PGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPP 810 P P P P P P P PPPP PP PP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSP-EPPPPSSLEPPPPPP 185 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P Q P P PPP PPP PP P P PP Sbjct: 856 PSVLQPPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVPP 898 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXX--GQRPXPXGXXPGXPPPXXPPP-PRXPXPPXXPPPXAPXXPP 834 PP + P P Q P P PP PPP P P PPP +P P Sbjct: 849 PPLGHSLPSVLQPPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSPLLSP 907 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP P P PP PPP PP Sbjct: 485 PPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSP-PPPPPSPPPPCPESSPP 539 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PPP P P PPP P Sbjct: 494 PPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPP--PCPESSPPPPVVYYAP 547 Score = 31.5 bits (68), Expect = 0.81 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP---XXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PPP PPPP P PPP PP Sbjct: 441 PPPP---PYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSP-PPPPYVYSSPP 495 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P P P P P P PPP +P P Sbjct: 599 PPSPVYYPQVTPSPPP---PSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYP 651 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P P P P P P PPP +P P Sbjct: 614 PPSPLYYPPVTPSPPP---PSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYP 666 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP----XXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P P PPP PPPP P PPP PP Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSP--PPPYVYSSPP 514 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX----PPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PPPP P PPP PP Sbjct: 475 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPP--SPPPP 532 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P P P P P P P P P P P PPP Sbjct: 629 PPSPVYYPPVTPSPPP---PSPVYYPPVTPSPPPPSPVYYPSETQSPPP 674 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = +1 Query: 745 PGXPPPXXPPPP----RXPXPPXXPPPXAPXXPP 834 P PPP P PP PP PPP P PP Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P P P P P P P P PP PPP P Sbjct: 689 PPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPP-----PXXPPPPRXPXPPXXPPPXAPXXP 831 PP P A P + P P PP PPPP P PP AP P Sbjct: 733 PPPPPAPPTPQSNGISAMKSSPPA--PPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAP 790 Query: 832 P 834 P Sbjct: 791 P 791 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = +1 Query: 754 PPPXXPPPPRX-----PXPPXXPPPXAPXXPP 834 PPP PPPP PP PPP AP PP Sbjct: 689 PPPPPPPPPMQHSTVTKVPP--PPPPAPPAPP 718 Score = 29.9 bits (64), Expect = 2.5 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 7/63 (11%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP-------XXPPPXAPX 825 PP P A P P P PPP PPPP P P P AP Sbjct: 708 PPPPPAPPAP---------PTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPP 758 Query: 826 XPP 834 PP Sbjct: 759 APP 761 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P P P PPPP P P P PP Sbjct: 757 PPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPP--PKLGTKLSPSGPNVPP 810 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP +T P P P P PPPP P PP P P Sbjct: 696 PPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPP--PPPPAPPTP 742 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX--PPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PPPP PP PPP PP Sbjct: 125 PPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPP--PPPTITRSPP 180 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PP P PPP PP Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPP 117 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PP P PPP PP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPP 99 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PP P PPP PP Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPP 126 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PP P PPP PP Sbjct: 98 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPP 153 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PP P PPP PP Sbjct: 80 PPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPP 135 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PP P PPP PP Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPP 144 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PP P PPP PP Sbjct: 107 PPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPP 162 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PPP PP P PPP PP Sbjct: 116 PPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPP 171 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +1 Query: 685 TPGXXXGPXXGQRPXPXGXXPGXPPP----XXPPPPRXPXPPXXPPPXAPXXPP 834 T P P P PPP PPPP PP P +P PP Sbjct: 31 TSAPEPAPLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 84 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPP P PPP PP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPP-PPVLLSPPPPPVNLSPP 108 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG G GGG GG G GGG GG G G Sbjct: 72 GGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSG 106 Score = 33.1 bits (72), Expect = 0.26 Identities = 22/61 (36%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXG-XGGXXX 657 GG G G GG G G GG GGG G G G G + G + G GG Sbjct: 57 GGVSGPGGNLGYGGFG--GAGGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSGGSTGGVHF 114 Query: 656 P 654 P Sbjct: 115 P 115 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GG G GGG G GG G GGG G Sbjct: 69 GGFGGAGGGLGGGLGGGAGSGLGGGLGG 96 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PG P P P PP PPP +P PP Sbjct: 54 PGPDPKHDPTKPGYGFPPPPPPPLSPPPPP 83 Score = 31.9 bits (69), Expect = 0.61 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 717 PTARXXGXXPRXPPPXXPPPPP 782 PT G P PPP PPPPP Sbjct: 62 PTKPGYGFPPPPPPPLSPPPPP 83 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP 798 P G P PG P PPPP P PP Sbjct: 52 PEPGPDPKHDPTKPGYGFPPPPPPPLSPPPP 82 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGG 753 G GGG GG G GGGG GGG Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGGGG 232 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -1 Query: 833 GGXXGAXGG-GXXGGXGXRGGGGXXGGG 753 GG G GG G GG G GGGG GG Sbjct: 211 GGGGGLGGGNGSGGGGGGGGGGGRISGG 238 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 796 GGXGXGGGGGXXGGGXR 746 GG G GGGGG GGG R Sbjct: 218 GGNGSGGGGGGGGGGGR 234 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXP 747 GG G G GG G GGG GG P Sbjct: 213 GGGLGGGNGSGGGGGGGGGGGRISGGSSP 241 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGG 403 GG G GGG G GG G GGGG Sbjct: 211 GGGGGLGGGNG--SGGGGGGGGGGG 233 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 748 GXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G PPP PPP + PP P P PP Sbjct: 228 GLPPPPPPPPHQAQPPPPPPSGLFPPPPP 256 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAP 822 P PPP PP P PPP P Sbjct: 232 PPPPPPHQAQPPPPPPSGLFPPPPPP 257 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P PPP PP P P P P P AP P Sbjct: 118 PPSSSPEANSPQSPASSPKPESLADSPSPPPP--PPQPESPSSPSYPEP-APVPAP 170 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 33.5 bits (73), Expect = 0.20 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPPPP P PP Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 744 PRXPPPXXPPPPPXP 788 P PPP PPPPP P Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 754 PPPXXPPPPRXPXPP 798 PPP PPPP P PP Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 769 PPPPRXPXPPXXPPP 813 PPPP P PP PPP Sbjct: 247 PPPPPPPPPPPPPPP 261 >At1g59359.1 68414.m06677 40S ribosomal protein S2 (RPS2B) similar to ribosomal protein S2 GI:430711 from [Drosophila melanogaster] Length = 284 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG GA GG G G GGG GG P G GR Sbjct: 5 GGESGAERGGDRGDFGRGFGGGRGGGRGRDRGPRGRGR 42 >At1g58983.1 68414.m06666 40S ribosomal protein S2, putative similar to ribosomal protein S2 GI:939717 from [Urechis caupo] Length = 284 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG GA GG G G GGG GG P G GR Sbjct: 5 GGESGAERGGDRGDFGRGFGGGRGGGRGRDRGPRGRGR 42 >At1g58684.1 68414.m06657 40S ribosomal protein S2, putative Length = 284 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG GA GG G G GGG GG P G GR Sbjct: 5 GGESGAERGGDRGDFGRGFGGGRGGGRGRDRGPRGRGR 42 >At1g58380.1 68414.m06642 40S ribosomal protein S2 (RPS2A) similar to ribosomal protein S2 GI:939717 from (Urechis caupo) Length = 284 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 GG GA GG G G GGG GG P G GR Sbjct: 5 GGEGGAERGGDRGDFGRGFGGGRGGGRGRDRGPRGRGR 42 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 33.5 bits (73), Expect = 0.20 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GG GG G GGG GGG G G+ G GV G G Sbjct: 72 GGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGG--AGKGVDGGAG 124 Score = 31.9 bits (69), Expect = 0.61 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Frame = -1 Query: 833 GGXXGAXGG---GXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GA GG G GG G GGG GGG G G G G + G G G Sbjct: 65 GGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGG--AGKGVDGGFGKGVDGGAGKGVDG 121 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG GG G GGG G G G G G + G G G Sbjct: 76 GGSVGGFGGGIGGGFG--GGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDG 129 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPXGXGGGX-GXTXGGXXGXXGGGGXXG 412 G GGG G GGG G + GG G GGG G Sbjct: 60 GGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGG 93 Score = 29.5 bits (63), Expect = 3.2 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXG-GGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GGG G G GG G GG G G G G + G G G Sbjct: 57 GGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDG 113 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G GG G GG G GGGG G Sbjct: 65 GGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGG 97 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GG GG G GGG GGG Sbjct: 174 GVDGGAIGGIGGGAGKEIGGGIGGGG 199 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GGG G GG G GGG G Sbjct: 72 GGWIGGSVGGFGGGIGGGFGG--GGFGGGAGKG 102 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 G GGG G G G G G G GG G Sbjct: 87 GGGFGGGGFGGGAGKGVDGGFGKGVDGGAG 116 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGP 702 G GA G G G + GGG GGG G G GR P GP Sbjct: 178 GNSNGAPWRGGQGRGGQQRGGGRGGGGRGG---GGRGRRPGKGP 218 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGP 702 G GA G G G + GGG GGG G G GR P GP Sbjct: 114 GNSNGAPWRGGQGRGGQQRGGGRGGGGRGG---GGRGRRPGKGP 154 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGP 702 G GA G G G + GGG GGG G G GR P GP Sbjct: 180 GNSNGAPWRGGQGRGGQQRGGGRGGGGRGG---GGRGRRPGKGP 220 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKR 423 G G GGGP G G G GGGG G P + Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPPK 142 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 10/39 (25%) Frame = -1 Query: 833 GGXXGAXGGGXX----------GGXGXRGGGGXXGGGXP 747 GG G GGG GG G GGGG GGG P Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 796 GGXGXGGGGGXXGGG 752 GG G GGGGG GGG Sbjct: 123 GGGGGGGGGGGGGGG 137 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 796 GGXGXGGGGGXXGGG 752 GG G GGGGG GGG Sbjct: 124 GGGGGGGGGGGGGGG 138 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 796 GGXGXGGGGGXXGGG 752 GG G GGGGG GGG Sbjct: 125 GGGGGGGGGGGGGGG 139 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 10/41 (24%) Frame = +2 Query: 329 GGPXGXGGGXGXT----------XGGXXGXXGGGGXXGXPK 421 GG G GGG G GG G GGGG G PK Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPPK 142 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 305 NXAGXEXGGGPXGXGGGXGXTXGG 376 N G + GGG G GGG G GG Sbjct: 116 NNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 787 GXGGGGGXXGGGXRGXXP 734 G GGGGG GGG G P Sbjct: 123 GGGGGGGGGGGGGGGGGP 140 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 793 GXGXGGGGGXXGGGXRG 743 G G GGGGG GGG G Sbjct: 123 GGGGGGGGGGGGGGGGG 139 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 787 GXGGGGGXXGGGXRGXXP 734 G GGGGG GGG G P Sbjct: 124 GGGGGGGGGGGGGGGGPP 141 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G GG GG GGGG GGG G G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG GGG G + GG G GGGG G Sbjct: 93 GRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G G GG GGGG GGG G Sbjct: 95 GGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G G G G GG GGGG GG G G G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGG 122 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +2 Query: 326 GGGPXGXGG-GXGXTXGGXXGXXGGGG 403 GGG G GG G G GG G GGGG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGG 114 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GGG GG GGGG G Sbjct: 91 GGGRGGSGGGYRSGGGGGYSGGGGGGYSG 119 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRW 717 GG G GG G GGG GGG G G W Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGGW 126 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -1 Query: 818 AXGGGXXGGXGXRGG--GGXXGGGXPGXXPXGXGRWPXXG 705 A G GG G RGG GG GG G G G + G Sbjct: 82 AQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGG 121 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 33.1 bits (72), Expect = 0.26 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P PPPP P PP P PP Sbjct: 40 PCQPNPSPPPPPSNPSPPPPSPTTTACPPP 69 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P P P PPPP P PP Sbjct: 40 PCQPNPSPPPPPSNPSPP 57 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/67 (31%), Positives = 23/67 (34%), Gaps = 11/67 (16%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-----------PRXPXPPXXPPP 813 PP P + G +R P P PPP PP R P PP PPP Sbjct: 100 PPPPPLSAITTTGHHHHRRSPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPP 159 Query: 814 XAPXXPP 834 P P Sbjct: 160 PPPTITP 166 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 747 RXPPPXXPPPPPXP 788 R PPP PPPPP P Sbjct: 118 RSPPPPPPPPPPPP 131 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 747 RXPPPXXPPPPPXP 788 R PPP PPPPP P Sbjct: 149 RSPPPPPPPPPPPP 162 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPPPP PP Sbjct: 122 PPPPPPPPPPTITPP 136 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPPPP PP Sbjct: 153 PPPPPPPPPPTITPP 167 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 PP P P P PPP PPPP P PP PP Sbjct: 123 PPPPPPPPPTITPPVTTTTAGHHHHRRSPPPP--PPPP--PPPPTITPP 167 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 33.1 bits (72), Expect = 0.26 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXP 807 P P P PPPPR P PP P Sbjct: 68 PPSPSPPPPPPPRPPPPPLSP 88 Score = 32.7 bits (71), Expect = 0.35 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAP 822 PP PPPP P PP PPP +P Sbjct: 68 PPSPSPPPPPPPRPP--PPPLSP 88 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -1 Query: 527 PWPXPXPXPPPXXXXRDLSRGVXGXGGAXRXSGGXLLGXPXAPPPPXXP 381 P P P P PPP LS G + L P PPPP P Sbjct: 69 PSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPP 117 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPPPP P PP Sbjct: 105 PPP--PPPPPPPPPP 117 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 14/49 (28%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXP--------------PXXPPPXAPXXPP 834 P P PPP PPPP P P PPP P PP Sbjct: 69 PSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPP 117 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PPP P PPP P P Sbjct: 71 PSPPPPPPPRPPPPPLSP 88 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P PP PPPP P P P PP Sbjct: 75 PPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPPSSTWDFWDPFIPP 130 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P P P PPPP P PP Sbjct: 68 PPSPSPPPPPPPRPPPPP 85 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/39 (48%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXR--GGGGXXGGGXPGXXPXGXG 723 GG GA GGG GG G + GGG GGG P G G Sbjct: 269 GGGKGA-GGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGG 306 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXP-GXXPXGXG 723 G G GGG G GGGG GG G P G G Sbjct: 301 GKNGGGGGGPNAGKKGNGGGGPMAGGVSGGFRPMGGG 337 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/55 (40%), Positives = 23/55 (41%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G A GGG GG G GGG GG PG G G+ G G G GG Sbjct: 259 GAPAAGGGGAGGGKG--AGGGAKGG--PGNQNQGGGK-NGGGGHPQDGKNGGGGG 308 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXGXPK 421 GGG G GG G GGGG PK Sbjct: 105 GGGGNNNNNKKGQKNGGGGGGGGGGGNSNAPK 136 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXP 690 G GGG G G GGG G G P G L P Sbjct: 100 GKAGGGGGGNNNNNKKGQKNGGGGGGGGGGGNSNAPKMGQQLNP 143 Score = 27.9 bits (59), Expect = 9.9 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GG GG GGGG P G G P + A G GG Sbjct: 318 GGGGPMAGGVSGGFRPMGGGGPQNMSMPMGGQMGMGGPMGNMPAVQGLPATGPGG 372 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = -1 Query: 830 GXXGAXGGGXXGGX---GXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVA 681 G A GGG G G G G GGG G P G GP L GVA Sbjct: 148 GAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAGPALGGGVA 200 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKRXPPE 435 G G G GP GG G P G G G A G P+ Sbjct: 175 GGGAGAGPALGGGGAGAGPALGGGVAGSGSALGGGASAGPD 215 Score = 29.9 bits (64), Expect = 2.5 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXP---XGXGRWPXXGPXLXPGVAXGXGGX 663 G GA G G G G GGG G P G G P G G A G GG Sbjct: 120 GSATGAGAGTGSALGGGPGAGSALGGG-AGAGPALGGGAGAGPALGGGAGAGSALGGGGA 178 Query: 662 XXPPPPXG 639 P G Sbjct: 179 GAGPALGG 186 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXG 675 G G G G G G G GGG G P G G L G + G Sbjct: 165 GGAGAGSALGGGGAGAGPALGGGGAGAGPALGGGVAGSGSALGGGASAG 213 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 G GGG G GGGG GGG G G G+ Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQ 63 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 314 GXEXGGGPX-GXGGGXGXTXGGXXGXXGGGGXXG 412 G E GGG GGG G + GG GGGG G Sbjct: 56 GGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGG 89 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXR----GGGGXXGGGXPGXXPXGXG 723 G G GGG GG G + GGGG GGG G G Sbjct: 47 GEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGG 87 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG G GGG G GGGG GG Sbjct: 68 GGGGGGSGGGQRSSSGGGGGGGEGDGG 94 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GGG GG G GGG G G G G+ G G G GG Sbjct: 46 GGEGGGGEGGGGEGGGGQKISKGG-GGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -1 Query: 833 GGXXGAXGGGXX-GGXGXRGGGGXXGGGXPG 744 GG G G G G G GGGG GGG G Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGG 60 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GGG GG G GGG GGG G G G G G G Sbjct: 44 GGGGEGGGGE--GGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGG 89 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +2 Query: 314 GXEXGGGPXG---XGGGXGXTXGGXXGXXGGG 400 G E GGG G GGG + GG G GGG Sbjct: 46 GGEGGGGEGGGGEGGGGQKISKGGGGGGSGGG 77 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G GGG + GG G G G G Sbjct: 68 GGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G G G G GG GGG G Sbjct: 45 GGGEGGGGEGGGGEGGGGQKISKGGGGGG 73 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +2 Query: 170 PXXXXXPXXXPXXXPXPXQXXXXXXRGL--KXNXGPPXPPPPP 292 P P P P Q +G K N PP PPPPP Sbjct: 359 PPLVYSPPPPPPPPPPFFQGLFSSKKGKSKKNNSNPPPPPPPP 401 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP 780 PP P P G ++ PPP PPPP Sbjct: 366 PPPPPPPPPFFQGLFSSKKGKSKKNNSNPPPPPPPPPP 403 Score = 25.8 bits (54), Expect(2) = 0.28 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 753 PPPXXPPPPP 782 PPP PPPPP Sbjct: 365 PPPPPPPPPP 374 Score = 25.8 bits (54), Expect(2) = 0.28 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 768 PPPPPXPXPP 797 PPPPP P PP Sbjct: 394 PPPPPPPPPP 403 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPG 744 G GGG GG G GGGG GG G Sbjct: 124 GTIGGGGQGGGGQGGGGGGAEGGTTG 149 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 400 GAXGXPKRXPPEXRXAPPXP--FTPRLRSRXXXXGGGXGXGXGXGXGG 537 G P PP +PP P +TP GG G G G G GG Sbjct: 95 GCCNQPPGPPPSTMYSPPYPYFYTPPYPYGTIGGGGQGGGGQGGGGGG 142 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 32.7 bits (71), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 769 PPPPRXPXPPXXPPPXAPXXPP 834 PPPP PP PPP P PP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPP 58 Score = 31.5 bits (68), Expect = 0.81 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P PP PPPPP P PP Sbjct: 41 PVYSPPISPPPPPPPPPP 58 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPP 813 PPP PP P PP PPP Sbjct: 39 PPPVYSPPISPPPPPPPPPP 58 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPP 813 PPP PP P PP PPP Sbjct: 38 PPPPVYSPPISPPPPPPPPP 57 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPP 798 P PP PPPP P PP Sbjct: 41 PVYSPPISPPPPPPPPPP 58 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP T P P P PP PP P P PP P PP Sbjct: 150 PPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPP 205 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/60 (33%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPP--PXXPPPPRXPX--PPXXPPPXAPXXPP 834 PP P P P + P P P P P PP + P PP PP +P PP Sbjct: 109 PPTPTVKPPSVQPPTY-KPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPP 167 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/54 (33%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP-RXPXPPXXPPPXAPXXPP 834 P +TP P Q P P PP PP + P P PP +P PP Sbjct: 91 PVSTPPIKLPPV--QPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPP 142 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P + P P P PP PP PP P P PP Sbjct: 104 PPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPP 146 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P PP PP + P P PP P P Sbjct: 141 PPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKP 175 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P + P P P P P P P P PPP AP P Sbjct: 92 PPAPKKSPPP---PTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPP-APKKSP 143 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/61 (31%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP--RXPXPPXXPPPX---APXXP 831 PP P +P P P P P PPP + P P PPP +P P Sbjct: 101 PPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPP 160 Query: 832 P 834 P Sbjct: 161 P 161 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/50 (28%), Positives = 15/50 (30%) Frame = +1 Query: 682 ATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 + P P P P P P PPP P PP P P Sbjct: 69 SAPAISISPSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVP 118 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P PPPP P P P PP Sbjct: 77 PSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPP 111 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G GG GG G G G G G G G GP + V G GG Sbjct: 146 GGGSGEGSGGGGGGDGSSGSGSGSGSG------SGSGTGTASGPDVYMHVEGGGGG 195 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GGG GG G G G G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGG 220 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 289 PXXXVKXSGXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXG 411 P + G G GGG GG G D G G GG G Sbjct: 183 PDVYMHVEGGGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GGG GG G GGGG G G G G Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSGGG 221 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GGG GG G G G G G GR G G G Sbjct: 96 GGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSG 150 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 G GG GG G GGGG GGG G Sbjct: 84 GRADCPGGIVVGGGGGGGGGGGGGGGSGG 112 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GGG GG G GGGG G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGG 220 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GGG G G G G GG G Sbjct: 194 GGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G + G G G G Sbjct: 96 GGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYG 128 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG GGG GG G GG G G G G Sbjct: 90 GGIVVGGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTG 126 >At1g50300.1 68414.m05639 zinc finger (Ran-binding) family protein / RNA recognition motif (RRM)-containing protein similar to SP|Q27294 RNA-binding protein cabeza {Drosophila melanogaster}; contains Pfam profiles: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 372 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GA GG G G RG GG GG PG P G Sbjct: 167 GASGGSMGAGRG-RGRGGGADGGAPGKQPSG 196 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP P PPP P Sbjct: 121 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSP 180 Query: 832 P 834 P Sbjct: 181 P 181 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP---XXPPPPRXPXPPXXPPPXAPXXPP 834 PP ++P P P P PPP PPPP PPP PP Sbjct: 143 PPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPP 201 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP-----XXPPPPRXPXPPXXPPPXAPXXP 831 PP P P Q P P PPP PPPP PPP P Sbjct: 161 PPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 220 Query: 832 P 834 P Sbjct: 221 P 221 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP-----XXPPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPP 170 Query: 832 P 834 P Sbjct: 171 P 171 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 181 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 240 Query: 832 P 834 P Sbjct: 241 P 241 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 201 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 260 Query: 832 P 834 P Sbjct: 261 P 261 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 221 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 280 Query: 832 P 834 P Sbjct: 281 P 281 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 241 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSP 300 Query: 832 P 834 P Sbjct: 301 P 301 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 261 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSP 320 Query: 832 P 834 P Sbjct: 321 P 321 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 71 PPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 130 Query: 832 P 834 P Sbjct: 131 P 131 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 271 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSP 330 Query: 832 P 834 P Sbjct: 331 P 331 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 281 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSP 340 Query: 832 P 834 P Sbjct: 341 P 341 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXX--PPPPRXPXPPXXPPPXAPXXPP 834 P TP P P P PPP PPP PP PPP PP Sbjct: 29 PTPTPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPP--PPPYVYSSPP 81 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 171 PPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 230 Query: 832 P 834 P Sbjct: 231 P 231 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 191 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 250 Query: 832 P 834 P Sbjct: 251 P 251 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 211 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 270 Query: 832 P 834 P Sbjct: 271 P 271 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 231 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 290 Query: 832 P 834 P Sbjct: 291 P 291 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 251 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSP 310 Query: 832 P 834 P Sbjct: 311 P 311 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 81 PPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 140 Query: 832 P 834 P Sbjct: 141 P 141 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG GG GG G GGG G G G GR+ G G GG Sbjct: 54 GGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGG 109 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXG 675 GG GG GG G GGG G G G GR+ G G + G Sbjct: 61 GGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGG 113 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/52 (34%), Positives = 20/52 (38%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G GG G G +GGGG GG G G G + G G GG Sbjct: 45 GDNGGNYNNGGGYQGGGGNYQGGG-GNYQGGGGNYQGGGGRYQGGGGRYQGG 95 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 305 NXAGXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 N G GGG GGG G GG GGGG Sbjct: 52 NNGGGYQGGGGNYQGGG-GNYQGGGGNYQGGGG 83 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG GA GGG GG G + G GGG Sbjct: 866 GGFAGAAGGGGFGGFGGQAQGQAGGGG 892 >At5g22790.1 68418.m02664 expressed protein Length = 433 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXL 696 G G GG GG G GGGG G G G GP L Sbjct: 104 GDENGNNDGGGNGGNGDGGGGGGDGEGDDGEDEADKAEEKEFGPIL 149 >At4g32340.1 68417.m04603 expressed protein Length = 238 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWP 714 GG G GG GG G GGGG GG G R+P Sbjct: 85 GGSNGGFGG--RGGDGAGGGGGGGGGSVDGYYEEMIQRYP 122 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 31.9 bits (69), Expect = 0.61 Identities = 20/55 (36%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPP-PRXPXP-PXXPPPXAPXXPP 834 P ++ G P P P P P P PPP P P P P PPP PP Sbjct: 40 PMSSGGGSSVPPPVMSPMPMMTPP--PMPMTPPPMPMTPPPMPMAPPPMPMASPP 92 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +1 Query: 649 GGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP 807 GGG PP + P P P P P P PPP PP P Sbjct: 44 GGGSSVPPPVMSPMPMMTPPPMPMTPPPMPMTP-PPMPMAPPPMPMASPPMMP 95 Score = 29.5 bits (63), Expect = 3.2 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP-PXXPPPXAP 822 GGG PP P P P P P PP P P P P PP P Sbjct: 44 GGGSSVPPP--------VMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMP 95 Query: 823 XXP 831 P Sbjct: 96 MTP 98 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-XPXPPXXPPPXAPXXP 831 P P +TP P P P PP PP P PP AP P Sbjct: 138 PSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPDSETLTPPPAPLPP 193 >At3g29060.1 68416.m03635 EXS family protein / ERD1/XPR1/SYG1 family protein similar to PHO1 protein [Arabidopsis thaliana] GI:20069032; contains Pfam profiles PF03105: SPX domain, PF03124: EXS family Length = 794 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +2 Query: 251 LKXNXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXG 361 L+ PP PPPPP + + GG G GGG G Sbjct: 37 LQKQQRPPPPPPPPSTG-DTVPLKTDGGEGGGGGGGG 72 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 31.9 bits (69), Expect = 0.61 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 9/62 (14%) Frame = -1 Query: 812 GGGXXGGXGXRGGG-GXXGGGXPGXXPXGXG---RWPXXGPXL-----XPGVAXGXGGXX 660 GGG G RGGG G GG P G G R P GP PG G GG Sbjct: 25 GGGGGPAFGGRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGGH 84 Query: 659 XP 654 P Sbjct: 85 GP 86 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXAT-PGXXXGPXXGQRPXPXGXXPGXPPP--XXPPPPRXP-XPPXXPPPXAPXXPP 834 PP P T PG Q P P PPP PP P P P P P PP Sbjct: 34 PPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P + P P PG PP P P PPP P P Sbjct: 17 PPPPTDPYHQYYQHQARPPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGP 71 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 8/34 (23%) Frame = +1 Query: 757 PPXXPPPPRXP--------XPPXXPPPXAPXXPP 834 PP PPPP P P PPP P PP Sbjct: 13 PPSGPPPPTDPYHQYYQHQARPPVPPPTQPGGPP 46 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXAT-PGXXXGPXXGQRPXPXGXXPGXPPP--XXPPPPRXP-XPPXXPPPXAPXXPP 834 PP P T PG Q P P PPP PP P P P P P PP Sbjct: 34 PPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P + P P PG PP P P PPP P P Sbjct: 17 PPPPTDPYHQYYQHQARPPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGP 71 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 8/34 (23%) Frame = +1 Query: 757 PPXXPPPPRXP--------XPPXXPPPXAPXXPP 834 PP PPPP P P PPP P PP Sbjct: 13 PPSGPPPPTDPYHQYYQHQARPPVPPPTQPGGPP 46 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 31.9 bits (69), Expect = 0.61 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = -1 Query: 833 GGXXGAXG-GGXXGGXGXRGGGGXXGGGXPG---XXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G G GG GG G +GGG GG G G G G G+ G G Sbjct: 44 GGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGLG 102 Score = 31.5 bits (68), Expect = 0.81 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -1 Query: 833 GGXXGAXGGG----XXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G GGG GG G + GG GGG G G G Sbjct: 15 GGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGG 55 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G E G G GGG G T GG G GGG G Sbjct: 45 GGEGTSGEGGGGGGDG-TKGGGDGISGGGHGDG 76 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXG--GGXPGXXPXGXG 723 G GGG G G GGGG G GG G G G Sbjct: 40 GGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHG 74 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGG-GXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GGG G G G G GGG G G GR G L G+ G G Sbjct: 56 GGGDGTKGGGDGISGGGHGDGLGCSGGG--GDGTKGGGR---RGDGLGRGLGRGGG 106 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG GGG T GG G GG G Sbjct: 15 GGGDGTKGGGNTITGGGGEGKKKNGGGEG 43 >At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family protein Common family member: At2g32840 [Arabidopsis thaliana] Length = 332 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PPP PPP P PP P AP P Sbjct: 34 PPPSQPPPAPPPLPPPTYRPIAPLRHP 60 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPP P P PP Sbjct: 34 PPPSQPPPAPPPLPP 48 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPX-GXXPGXPPPXXPPPPRXPXPPXXPP-PXAPXXPP 834 P P ATP P P P P PP P P P PP P P P Sbjct: 34 PPPVATPPPAATPAPTTTPPPAVSPAPTSSPPSSAPSPSSDAPTASPPAPEGPGVSP 90 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXX-PPPPRXPXPPXXPPPXAPXXP 831 Q P P PPP PPP P P PPP P Sbjct: 22 QAPAPSPTTTVTPPPVATPPPAATPAPTTTPPPAVSPAP 60 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 31.5 bits (68), Expect = 0.81 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPP 810 P PPP PP R P PP PP Sbjct: 381 PYGPPPGPPPMMRPPLPPGPPP 402 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 7/56 (12%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPP-------PXXPPPPRXPXPPXXPPP 813 PP P P G P P PG PP P PPPP+ P PPP Sbjct: 200 PPLPPLPP--TTGLTLPHSPFPP-PPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPP 252 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPX--PPXXPPPXAP 822 P PPP PPP PP PPP P Sbjct: 217 PFPPPPPGPPPKEQDFVRPPLPPPPQLP 244 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQ---RPXPXGXXPGXPPPXXPPPPRXPXP 795 PP P G G RP P G PG PP PP P P P Sbjct: 358 PPPPLDMHPPHPGMFVGHLIPRP-PYGPPPGPPPMMRPPLPPGPPP 402 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPP 813 P PP PPP P P PPP Sbjct: 380 PPYGPPPGPPPMMRPPLPPGPPP 402 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPR--XPXPPXXPPPXAPXXP 831 P P P P PP P P PP PPP P P Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 P P PP P PP P PP PP A Sbjct: 166 PFSPSIPPPSPPYFPPEPPSIPPPPPPSPPSA 197 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +1 Query: 757 PPXXP--PPPRXPXPPXXPPPXAPXXPP 834 PP P PPP P P PP P PP Sbjct: 165 PPFSPSIPPPSPPYFPPEPPSIPPPPPP 192 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PPP PP P P PP P PP Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPP 184 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 329 GGPXGXGGGXGXTXGGXXGXXGGGG 403 GG G GG G + GG G GGGG Sbjct: 78 GGNSGGSGGLGGSGGGGGGSGGGGG 102 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGR 720 G GG GG G GGGG GG G G G+ Sbjct: 78 GGNSGGS-GGLGGSGGGGGGSGGGGGDGSDGKGK 110 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 818 AXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 A GG GG G GG G GGG G G Sbjct: 75 AVPGGNSGGSGGLGGSGGGGGGSGGGGGDG 104 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GG GG G GGGG G Sbjct: 82 GGSGGLGGSGGGGGGSGGGGGDGSDG 107 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G G G GG G GGGG G G Sbjct: 82 GGSGGLGGSG--GGGGGSGGGGGDGSDGKG 109 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 31.5 bits (68), Expect = 0.81 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P Q+P P P P PP P+ PP PP P PP Sbjct: 335 PQYPQQPPPQLQHPSGYNPEEPPYPQQSYPP-NPPRQPPSHPP 376 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 706 PXXGQ-RPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P GQ +P P P PP PP PP PPP P P Sbjct: 299 PPSGQSQPPPTIQPPYQPP---PPTQSLHQPPYQPPPQQPQYP 338 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 P P PPP PP R PP PPP P Sbjct: 33 PPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPP----XAPXXPP 834 PPP PP R PP PPP AP PP Sbjct: 30 PPPPPPPLMRRRAPPPPPPPLMRRRAPPPPP 60 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 9/34 (26%) Frame = +1 Query: 760 PXXPPPP-----RXPXPPXXPPP----XAPXXPP 834 P PPPP R P PP PPP AP PP Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPP 47 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 P P P P P PPP P R PP PPP Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPP 63 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 Q P P PP PP PP PP P PP Sbjct: 30 QPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPP 68 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PP PP PP PP P PP Sbjct: 27 PPSQPPSHPPIQPSSQPPTQPPSQPPTQPP 56 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P Q P P PP PP PP PP +P P Sbjct: 28 PSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQP 79 >At3g51770.1 68416.m05677 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 958 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 260 NXGPPXPPPPPXXX*NXAGXEXGGGPXGXGGGXG 361 N P PPPPP + G GGG G GG G Sbjct: 27 NPSAPTPPPPPGN--SSTGGGGGGGSGGGTGGVG 58 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 517 APXPXPPPXTXXGT*AGG*XGXGGRTGXXG 428 AP P PPP T GG G GG TG G Sbjct: 30 APTPPPPPGNS-STGGGGGGGSGGGTGGVG 58 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 754 PPPXXPPPPRXPX--PPXXPPPXAPXXPP 834 PPP PPP P PP PP P PP Sbjct: 64 PPPADLPPPPTPYYSPPADLPPPTPIYPP 92 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P PP P P P P PPP P P Sbjct: 38 PQHSPLPSPVYSSPADLPPP-PTPVYSPPPADLPPPPTPYYSP 79 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/56 (30%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP-PXXPPPXAPXXP 831 P ++P P P P P P PP P P P PPP A P Sbjct: 44 PSPVYSSPADLPPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPP 99 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 PP P TP P P P P PP P P P PPP A Sbjct: 55 PPPP--TP--VYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPPQA 101 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 31.5 bits (68), Expect = 0.81 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P PPP PP P P PPP P PP Sbjct: 44 PSPSSVHRPYPPP--PPLPDFAPQPLLPPPSPPPPPP 78 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 685 TPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 TP P RP P P P P P P P P PPP A Sbjct: 39 TPPVDPSPSSVHRPYP----PPPPLPDFAPQPLLPPPSPPPPPPA 79 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -2 Query: 403 PPPPXXPXXXPXGPAXXPPSXXGAPPXFXXRXVLXG 296 PPPP P P P PPS PP + + G Sbjct: 54 PPPPPLPDFAPQ-PLLPPPSPPPPPPAYTINTRIYG 88 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 31.5 bits (68), Expect = 0.81 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQR--PXPXGXXP----GXPPPXXPPPPRXPXPPXXPPPXA 819 PP TPG GP + P G P G PP PPP P P P A Sbjct: 209 PPESGYTPGPVLGPPYSEPGPSTPTGSIPSPSSGFLPPIVYPPPMAPPSPSVTPTSA 265 >At1g77030.1 68414.m08970 glycine-rich protein Length = 349 Score = 31.5 bits (68), Expect = 0.81 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 GG GA GG G G RGG GGG Sbjct: 208 GGRGGARGGRGGGARGGRGGSRDFGGG 234 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 31.5 bits (68), Expect = 0.81 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXP 831 PP PPPR P P PP P P Sbjct: 227 PPSPSAPPPRSPPPKSSPPSSLPQTP 252 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPP---PRXPXPP--XXPPPXAP 822 P P P PPP PP P+ P PP PP P Sbjct: 228 PSPSAPPPRSPPPKSSPPSSLPQTPSPPLVFTPPQNVP 265 >At1g54060.1 68414.m06160 expressed protein similar to 6b-interacting protein 1 (NtSIP1) [Nicotiana tabacum] GI:18149189 Length = 383 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPG 744 GGG G RGGGG GGG G Sbjct: 67 GGGGSGNRNGRGGGGGSGGGGGG 89 >At1g28240.1 68414.m03466 expressed protein Length = 581 Score = 31.5 bits (68), Expect = 0.81 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 747 RXPPPXXPPPPPXPXPP 797 R P P PPPPP P PP Sbjct: 519 RPPVPNFPPPPPSPPPP 535 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 31.5 bits (68), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGG 753 G GGG GG G R GG GGG Sbjct: 66 GGGGGGGRGGGGARSGGRSRGGG 88 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWP 714 GG G GGG G RGGGG G G P Sbjct: 68 GGGGGRGGGGARSGGRSRGGGGGSSSSRSRDWKRGGGVVP 107 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGG 753 GGG GG G RGGGG GG Sbjct: 65 GGG--GGGGGRGGGGARSGG 82 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GGG G G G G G GGGG Sbjct: 65 GGGGGGGGRGGGGARSGGRSRGGGGG 90 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGX-RGGGGXXGGGXPG 744 G GA GGG G G R GGG GGG G Sbjct: 92 GGGGARGGGYGYGSGNGRSGGGGGGGGFNG 121 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 GGG G G G G G G GGGG G Sbjct: 93 GGGARGGGYGYGSGNGRSGGGGGGGGFNG 121 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPP 810 PPP PPPPR P PP Sbjct: 136 PPPPPPPPPRSPNSASPPP 154 >At4g39680.1 68417.m05614 SAP domain-containing protein contains Pfam domain PF02037: SAP domain Length = 633 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +1 Query: 721 RPXPXGXXPGXPPPXXPPP---PRXPXPPXXPPPXAP 822 RP P P PPP PP R P PP PPP AP Sbjct: 558 RPPPTALPP--PPPLAKPPHVVERLPLPP--PPPIAP 590 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 747 RXPPPXXPPPPPXPXPP 797 R PP PPPPP PP Sbjct: 558 RPPPTALPPPPPLAKPP 574 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P P PPP+ PP P P PP Sbjct: 216 PPPKKEVP-PPVPVYKPPPKVELPPPIPKKPCPPKPP 251 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/58 (29%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP--XXPPPXAPXXPP 834 PP P ++P P P P PP + P PP PPP PP Sbjct: 279 PPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPP 336 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/59 (28%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP---XXPPPXAPXXPP 834 PP P ++P P P P PPP+ PP PPP PP Sbjct: 300 PPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPP 358 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP---PPXAPXXPP 834 P + P P P P P P P PPP+ PP P PP PP Sbjct: 183 PPKYSPPVEVPPPVPVYEPPPKKEIP-PPVPVYDPPPKKEVPPPVPVYKPPPKVELPP 239 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P PP PP P P PPP PP Sbjct: 240 PIPKKPCPPKPPKIEHPP---PVPVYKPPPKIEKPPP 273 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P P P P P PPP+ PP P P P Sbjct: 245 PCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKP 298 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 730 PXGXXPGXPPPXXPPPPRXPXPPXXP-PPXAPXXPP 834 P P PP P PP P P P P +P PP Sbjct: 22 PPEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPPP 57 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP PPP PPP P PP Sbjct: 44 PPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 Score = 28.3 bits (60), Expect = 7.5 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 744 PRXPPPXXPPPPP 782 P PPP PPPPP Sbjct: 42 PHPPPPPPPPPPP 54 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 759 PXXPPPPPXPXPP 797 P PPPPP P PP Sbjct: 42 PHPPPPPPPPPPP 54 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 G GGG GG G G G GGG G G G Sbjct: 400 GGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGG 432 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXP- 654 G GG G RGGGG PG P G P P + G G P Sbjct: 80 GGENHASGGMGGTSATRGGGGEP--VIPGAPPPNRGGGETVIPGAPPPIRGGGGEPAIPG 137 Query: 653 -PPP 645 PPP Sbjct: 138 APPP 141 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G G GG G RGGG GGG G Sbjct: 454 GGEQGVTGSDGGGGRG-RGGGKVAGGGKKG 482 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GG G G G G GGG G W G V G GG Sbjct: 317 GNKGGNGGSIKIGVGTNGITGGTGGGEAGAGMQVMQGWGGGGSGAATQVMQGCGG 371 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-----XPXPPXXPP 810 GGG P P G P P P G P PPP+ P P PP Sbjct: 113 GGGETVIPGAPPPIRGGGGEPAIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPP 172 Query: 811 P 813 P Sbjct: 173 P 173 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-----XPXPPXXPP 810 GGG P P G P P P G P PPP+ P P PP Sbjct: 129 GGGEPAIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPP 188 Query: 811 P 813 P Sbjct: 189 P 189 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-----XPXPPXXPP 810 GGG P P G P P P G P PPP+ P P PP Sbjct: 145 GGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPP 204 Query: 811 P 813 P Sbjct: 205 P 205 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR-----XPXPPXXPP 810 GGG P P G P P P G P PPP+ P P PP Sbjct: 161 GGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPP 220 Query: 811 P 813 P Sbjct: 221 P 221 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPG 744 GG G GGG G GGGG G G G Sbjct: 401 GGGGGGDGGGGQGTGIGGGGGGEQGTGVGG 430 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 328 GGPPXXRGGXGXD--PXGXXGXXGGGGAXGXPKRXPPE 435 G PP RGG G P GGGG P PP+ Sbjct: 217 GAPPPKRGGGGEPVIPGAPLPKRGGGGESVVPGAPPPK 254 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GGG G GG G G G G Sbjct: 398 GCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGG 430 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 Q P P G P PPP PP PP AP P Sbjct: 623 QVPQPYGQLPPLSMGMMQPPPMAEMPPPPPPGEAPPPLP 661 >At5g66960.1 68418.m08442 prolyl oligopeptidase family protein similar to OpdB [Treponema denticola] GI:13786054; contains Pfam profiles PF00326: prolyl oligopeptidase family, PF02897: Prolyl oligopeptidase, N-terminal beta-propeller domain Length = 792 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXP 807 P PP PPPP P PP P Sbjct: 26 PPKSPPPPPPPPALPKPPKKP 46 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P+ PPP PPPP P PP Sbjct: 27 PKSPPPP-PPPPALPKPP 43 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXP-PPXAP 822 PP PPPP P PP P PP P Sbjct: 26 PPKSPPPP--PPPPALPKPPKKP 46 >At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP|P30185 Dehydrin Rab18 {Arabidopsis thaliana} Length = 186 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG G GGG G T G G G G G Sbjct: 28 GNPMGGGGYGTGGGGGATGGQGYGTGGQGYGSG 60 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG GGG GG G GG G G G G G Sbjct: 34 GGYGTGGGGGATGGQGYGTGGQGYGSGGQGYGTGGQG 70 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPPXAP 822 PP PPP P PP PP P Sbjct: 403 PPLSTPPPARPCPPVYSPPPPP 424 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +1 Query: 649 GGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 G PP +P P P PPP P PP PP P AP Sbjct: 376 GSSCFSPPPSQISPS---SQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPPPPLSLAP 430 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP PPPP P PPP P P Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPPDP 123 >At5g11550.1 68418.m01347 expressed protein Length = 314 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 753 PPPXXPPPPPXPXP 794 PPP PPPPP P P Sbjct: 80 PPPPHPPPPPPPLP 93 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP---PXXPPPXAPXXPP 834 PP P A P G P P P P PP P P P P P P PP Sbjct: 191 PPQPSAYPPPSTS---GYPPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPPPP 246 Score = 29.1 bits (62), Expect = 4.3 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 10/65 (15%) Frame = +1 Query: 670 PXPXATP--GXXXGPXXGQRPXPXGXXP--GXP--PPXXPPPPRXPXPP----XXPPPXA 819 P A P G P Q P P G P G P P PPP PP PPP + Sbjct: 159 PYSTAPPYSGPSLYPQVQQYPQPSGYPPASGYPPQPSAYPPPSTSGYPPIPSAYPPPPPS 218 Query: 820 PXXPP 834 PP Sbjct: 219 SAYPP 223 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/49 (30%), Positives = 15/49 (30%), Gaps = 1/49 (2%) Frame = +1 Query: 688 PGXXXGPXXGQRPXPX-GXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P P P P PPPP PP PP P Sbjct: 186 PASGYPPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQPSYYP 234 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 753 PPPXXPPPPPXPXP 794 PPP PPPPP P P Sbjct: 427 PPPPPPPPPPPPPP 440 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 756 PPXXPPPPPXPXPP 797 PP PPPPP P PP Sbjct: 427 PPPPPPPPPPPPPP 440 >At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 580 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGG 753 G GGG GG RGG G GGG Sbjct: 24 GGGGGGHGGGGHGRGGHGRGGGG 46 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGG--XXGGG 753 GG G GGG G RGGGG GGG Sbjct: 25 GGGGGHGGGGHGRGGHGRGGGGIFFFGGG 53 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 30.7 bits (66), Expect = 1.4 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 8/66 (12%) Frame = +1 Query: 640 PXGGGGXXXPPX---PXATP--GXXXGPXXGQRPXPXGXXPG-XPPPXXPPPPRXPXPP- 798 P GGG P P + P G GP G RP G P P PPP P P Sbjct: 133 PLVGGGSSFPQPGGFPASGPPGGVPSGPPSGARPIGFGSPPPMGPGMSMPPPSGMPGGPL 192 Query: 799 -XXPPP 813 PPP Sbjct: 193 SNGPPP 198 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/67 (29%), Positives = 22/67 (32%), Gaps = 4/67 (5%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPP----PPRXPXPPXXPPP 813 G G PP + RP P PG PPP PP+ P PP Sbjct: 54 GSGPRPSPPFGQSPQSFPQQQQQQPRPSPMAR-PGPPPPAAMARPGGPPQVSQPGGFPPV 112 Query: 814 XAPXXPP 834 P PP Sbjct: 113 GRPVAPP 119 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 212 PXPXQXXXXXXRGLKXNXGPPXPPPPPXXX*NXAGXEXGGGP 337 P P RG + GP PPPP AG G P Sbjct: 225 PPPMMGPGAFPRGSQFTSGPMMAPPPPYGQPPNAGPFTGNSP 266 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 G G GG GG G GGGG GGG Sbjct: 190 GRYSGDGGGFGGGGSGFGGGGGGGGGG 216 >At3g05220.2 68416.m00570 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 478 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GGG G G G GG G G P G GP G G GG Sbjct: 323 GGGPMGPGGPMGPGGPMGQGGPMGMMGPGGPMSMMGPGGPMGPMGGQGG 371 >At3g05220.1 68416.m00569 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 577 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GGG G G G GG G G P G GP G G GG Sbjct: 422 GGGPMGPGGPMGPGGPMGQGGPMGMMGPGGPMSMMGPGGPMGPMGGQGG 470 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP P PPR PPP P P Sbjct: 194 PPPPPPPTPRPPRLLSSQPAPPPTPPVSLP 223 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 753 PPPXXPPPPPXPXPP 797 PPP PPPPP P PP Sbjct: 193 PPP--PPPPPTPRPP 205 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP---XXPPPPRXPXPPXXPPPXAPXXPP 834 PP P ++P P P P P PP PP P PPP P P Sbjct: 70 PPPPSSSPLSSLSPSLS--PSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSP 126 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP-----XXPPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 351 PPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 410 Query: 832 P 834 P Sbjct: 411 P 411 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 71 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSP 130 Query: 832 P 834 P Sbjct: 131 P 131 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 170 Query: 832 P 834 P Sbjct: 171 P 171 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 151 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 210 Query: 832 P 834 P Sbjct: 211 P 211 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 171 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 230 Query: 832 P 834 P Sbjct: 231 P 231 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 191 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 250 Query: 832 P 834 P Sbjct: 251 P 251 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 211 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 270 Query: 832 P 834 P Sbjct: 271 P 271 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 231 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 290 Query: 832 P 834 P Sbjct: 291 P 291 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 251 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 310 Query: 832 P 834 P Sbjct: 311 P 311 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 271 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 330 Query: 832 P 834 P Sbjct: 331 P 331 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 371 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 430 Query: 832 P 834 P Sbjct: 431 P 431 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP-----XXPPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 51 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSP 110 Query: 832 P 834 P Sbjct: 111 P 111 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 131 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 190 Query: 832 P 834 P Sbjct: 191 P 191 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPP-----XXPPPPRXPXPPXXPPPXAPXXP 831 PP P P + P P PPP PPPP PPP P Sbjct: 331 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSP 390 Query: 832 P 834 P Sbjct: 391 P 391 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 121 PPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 180 Query: 832 P 834 P Sbjct: 181 P 181 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 141 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 200 Query: 832 P 834 P Sbjct: 201 P 201 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 161 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 220 Query: 832 P 834 P Sbjct: 221 P 221 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 181 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 240 Query: 832 P 834 P Sbjct: 241 P 241 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 201 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 260 Query: 832 P 834 P Sbjct: 261 P 261 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 221 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 280 Query: 832 P 834 P Sbjct: 281 P 281 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 241 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 300 Query: 832 P 834 P Sbjct: 301 P 301 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 261 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 320 Query: 832 P 834 P Sbjct: 321 P 321 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 281 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSP 340 Query: 832 P 834 P Sbjct: 341 P 341 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 301 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSP 360 Query: 832 P 834 P Sbjct: 361 P 361 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 361 PPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 420 Query: 832 P 834 P Sbjct: 421 P 421 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 381 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 440 Query: 832 P 834 P Sbjct: 441 P 441 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 401 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSP 460 Query: 832 P 834 P Sbjct: 461 P 461 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 81 PPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSP 140 Query: 832 P 834 P Sbjct: 141 P 141 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXX-----PPPPRXPXPPXXPPPXAPXXP 831 PP P P P P PPP PPPP PPP P Sbjct: 101 PPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSP 160 Query: 832 P 834 P Sbjct: 161 P 161 >At1g12380.1 68414.m01431 expressed protein Length = 793 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 756 PPXXPPPPPXPXPP 797 PP PPPPP P PP Sbjct: 14 PPPPPPPPPAPAPP 27 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/56 (28%), Positives = 18/56 (32%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P P +P P P P P PP+ P P AP P Sbjct: 70 PTPPKPKPAPAPTPPK-PKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKP 124 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +1 Query: 667 PPXPXATPGXXXG-PXXGQRPXPXGXXPGX---PPPXXP-PPPRXPXPPXXPPPXAPXXP 831 PP P TP P P P P PP P P P P P P P P Sbjct: 39 PPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPK 98 Query: 832 P 834 P Sbjct: 99 P 99 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP-PPPRXPXPPXXPPPXAPXXPP 834 P P TP P P PP P P P P P P P P P Sbjct: 33 PAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKP 88 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXP-PPPRXPXPPXXPPPXAPXXPP 834 P P TP P P PP P P P P P P P P P Sbjct: 55 PKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKP 110 Score = 28.3 bits (60), Expect = 7.5 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPR---XPXPPXXPPPXAPXXP 831 P P P P P PP P+ P PP P AP P Sbjct: 29 PKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPP 73 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P TP P P PP P P P P P AP P Sbjct: 66 PAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAP 120 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPR---XPXPPXXPPPXAPXXP 831 P P P P PP P+ P PP P AP P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPP 62 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P TP P P PP P P P P P P AP P Sbjct: 77 PAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKP-APKPAP 130 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 747 RXPPPXXPPPPPXPXPP 797 + PPP PP PP P PP Sbjct: 558 KSPPPIAPPGPPAPQPP 574 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 747 RXPPPXXPPPPPXPXPP 797 + PPP PP PP P PP Sbjct: 558 KSPPPIAPPGPPAPQPP 574 >At4g32375.1 68417.m04610 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to polygalacturonase [Lycopersicon esculentum] GI:4325090; contains Pfam profile PF00295: Polygalacturonase (pectinase) Length = 486 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPX--PXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P +P P + P P P PP PP P P P AP PP Sbjct: 406 PLAPAKSPRHVELPMPTKPPTMFPKPLAPAKPPRHVEPPMPTKPPTMFPKPLAPAKPP 463 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 744 PRXPPPXXPPPPPXPXPP 797 P+ PPP P P P P PP Sbjct: 104 PKRPPPPPPKPQPPPPPP 121 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPP PPP+ PP P P PP Sbjct: 104 PKRPPP---PPPKPQPPPPPPRSQKPMQPP 130 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPG 687 GGG G GG G GG G P G G P G PG Sbjct: 569 GGGGADYYGGGGGYGGVPGGGYGAMPGGYGPVPGGGYGNVPG 610 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGP 702 GG G G GG G GGG G P G G GP Sbjct: 583 GGVPGGGYGAMPGGYGPVPGGGYGNVPGGGYAPYGRGGGAYYGP 626 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPP 813 PPP PPPP P PPP Sbjct: 9 PPPPPPPPPSFRSIPRPPPP 28 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PPP PPP P PPP PP Sbjct: 10 PPPPPPPPSFRSIPRPPPPPSFRSIPP 36 >At3g47500.1 68416.m05166 Dof-type zinc finger domain-containing protein identical to H-protein promoter binding factor-2a GI:3386546 from [Arabidopsis thaliana] Length = 448 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 724 PXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P PPP PPP P P P P PP Sbjct: 294 PWPYTWNPAMPPPGFYPPPGYPM-PFYPYWTIPMLPP 329 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 30.3 bits (65), Expect = 1.9 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 9/74 (12%) Frame = +1 Query: 640 PXGGGGXXXPPXPX--ATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPR---XPXPP-- 798 P GG PP A P G G P P PPP PP P PP Sbjct: 255 PHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGGPRPPQN 314 Query: 799 --XXPPPXAPXXPP 834 PPP PP Sbjct: 315 YGGTPPPNYGGAPP 328 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +1 Query: 667 PPXPXATPGXXXGPXX--GQRPXPX--GXXPGXPPPXXPPPPRXPXPPXXPP 810 PP P G P G P P G G PPP PR P P PP Sbjct: 251 PPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPP 302 Score = 27.9 bits (59), Expect = 9.9 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXA 819 P GG PP A P G P P G PPP P PPP Sbjct: 286 PNNMGGPRHPPPYGAPPQNNMGG-----PRPPQNYGGTPPPNYGGAPPANNMGGAPPPNY 340 Query: 820 PXXPP 834 PP Sbjct: 341 GGGPP 345 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGG 756 GG G G GG G GGGG GG Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGG 86 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GGG G G GGG GGG G G Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGGSG 88 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 326 GGGPXGXGGGXGXTXGGXXGXXGGGG 403 GGG G GG + GG G G GG Sbjct: 64 GGGSTGNNGGGSGSGGGGGGFGGSGG 89 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPG 744 G GGG G G G G GGG G Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGG 86 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 341 GXGGGXGXTXGGXXGXXGGGGXXG 412 G GGG GG G GGGG G Sbjct: 62 GGGGGSTGNNGGGSGSGGGGGGFG 85 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXG 729 GG G GGG G G G GG G P G Sbjct: 65 GGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWG 99 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 652 GGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPP 798 G PP + P GP G P P P P PP+ P PP Sbjct: 86 GSRPPPPSSNSFPSPAYGPPGGA---PFQRFPSPPFPTTQNPPQGPPPP 131 >At2g44790.1 68415.m05574 uclacyanin II strong similarity to uclacyanin II GI:3399769 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin II GI:3399768 Length = 202 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +1 Query: 652 GGXXXPPXPXATPGXXX---GPXXGQRPXPXGXXPGXPPPXXPPPPR 783 G P P +TPG P G P P PG PPPP+ Sbjct: 130 GPPATPTPPSSTPGTPTTPESPPSGGSPTPTTPTPGAGSTSPPPPPK 176 >At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1050 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +1 Query: 328 GGPPXXRGGXGXDPXGXXGXXG-GGGAXGXPKRXPPEXRXAP 450 GGP +G P G G GGG G P PP+ + P Sbjct: 75 GGPQEYQGRGRGGPPHQGGRGGYGGGRGGGPSSGPPQRQSVP 116 >At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1048 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +1 Query: 328 GGPPXXRGGXGXDPXGXXGXXG-GGGAXGXPKRXPPEXRXAP 450 GGP +G P G G GGG G P PP+ + P Sbjct: 75 GGPQEYQGRGRGGPPHQGGRGGYGGGRGGGPSSGPPQRQSVP 116 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGG-GXXG--GGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 G G GG GG G GGG G G GG G G G G G+ G G Sbjct: 140 GGVGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLGKAGGIGVGGG 196 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = -1 Query: 830 GXXGAXGG--GXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXX 657 G G GG G GG G GG G GGG G G G + G GG Sbjct: 151 GGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLGKAGGIGVGGGIGGGHGV-VGGVID 209 Query: 656 PPP 648 P P Sbjct: 210 PHP 212 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -1 Query: 833 GGXXGAXGG-GXXGGXGXRGGGGXXGGGXPG 744 GG GA GG G GG G GG G GGG G Sbjct: 170 GGLGGAGGGLGGVGGLGKAGGIGV-GGGIGG 199 >At5g65180.2 68418.m08199 expressed protein contains Pfam domain, PF04818: Protein of unknown function, DUF618 Length = 311 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 735 GXXPRXPPPXXPPPPPXPXPP 797 G P PP PPPPP PP Sbjct: 255 GNIPLMPPGALPPPPPGTLPP 275 >At5g65180.1 68418.m08198 expressed protein contains Pfam domain, PF04818: Protein of unknown function, DUF618 Length = 439 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 735 GXXPRXPPPXXPPPPPXPXPP 797 G P PP PPPPP PP Sbjct: 383 GNIPLMPPGALPPPPPGTLPP 403 >At5g62440.1 68418.m07837 expressed protein Length = 202 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGG 753 G GGG GG G RGG G GG Sbjct: 172 GANGNGHGGGRGGGGGRRGGRGGGRGG 198 >At5g48290.1 68418.m05964 heavy-metal-associated domain-containing protein strong similarity to farnesylated proteins ATFP4 [GI:4097549] and ATFP5 [GI:4097551]; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 181 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +1 Query: 346 RGGXGXDPXGXXGXXGGGGAXGXPKRXPPEXRXAPPXPF 462 +GG G G G GG G + PPE + P P+ Sbjct: 84 KGGDGKGAEGKGGDQKGGDKKGPDDKEPPEPKPVPCYPW 122 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G G G G G GG GG G G G G G G GG Sbjct: 17 GSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGG 72 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXP---GXXPXGXGRWPXXGPXLXPGVAXGXGG 666 GG G G G G GG GG G G GR G G G GG Sbjct: 16 GGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGGG 74 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G+ G G G G G G G G G G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSG 41 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G GG G GGG G G G GGG G Sbjct: 46 GRGNGGRGSGRGGGRGDGRGDGRGIGGGGRGRG 78 >At4g35230.1 68417.m05007 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 512 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXP 747 GG A GG G G GGGG GGG P Sbjct: 30 GGATTADNGGSGGASGVGGGGG--GGGIP 56 >At4g17800.1 68417.m02656 DNA-binding protein-related contains Pfam domain PF03479: Domain of unknown function (DUF296), found in AT-hook motifs Pfam:PF02178 Length = 292 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWP 714 G G GG G GGGG G P P G P Sbjct: 63 GSGSSGGGGGHGGGGDVVGRRPRGRPPGSKNKP 95 >At3g18360.1 68416.m02335 VQ motif-containing protein contains PF05678: VQ motif Length = 285 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 744 PRXPPPXXPPPPPXP 788 P PPP PPPPP P Sbjct: 201 PPQPPPHPPPPPPPP 215 >At3g16350.1 68416.m02068 myb family transcription factor ; contains Pfam profile: PF00249 Myb-like DNA-binding domain Length = 387 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 812 GGGXXGGXGXRGGGGXXGG 756 GGG GG G GGGG GG Sbjct: 22 GGGTCGGSGGGGGGGGGGG 40 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXG 705 G GGG G G G G GGG G W G Sbjct: 61 GGGGGGSIGNHGGGSGSGGGGGGYGGSEEEESSPWGPLG 99 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGG 756 GG G G GG G GGGG GG Sbjct: 61 GGGGGGSIGNHGGGSGSGGGGGGYGG 86 >At3g07195.1 68416.m00858 proline-rich family protein Length = 225 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGGXXXPP 651 G G+ GGG G G G GGG G P G G GG PP Sbjct: 95 GGGGSGGGGRSGSGSAGGLYGGYGGGSVGNQRQPPAPRPTQPRQNLRGGNNGRGGTTIPP 154 Query: 650 PP 645 P Sbjct: 155 FP 156 >At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 1088 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +2 Query: 320 EXGGGPXGXGGGXGXTXGGXXGXXGG-GGXXG 412 + GGG G GGG GG G GG GG G Sbjct: 845 DSGGGFGGRGGGFSGREGGFGGREGGFGGREG 876 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXG 669 GG G GGG G G GG GG G GR+ G G G Sbjct: 847 GGGFGGRGGGFSGREGGFGGREGGFGGREGGFGGRGGRFGMRDDSFGRGGNRGRG 901 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXXG----PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P + P P PPP PPP P PPP PP Sbjct: 45 PPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPP--PYVYSSPPPPVKSPPP 102 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXX----GPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P + P P PPP PPP P PPP PP Sbjct: 61 PPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPP--PYYYHSPPPPVKSPPP 118 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 706 PXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P P PPP PPP P PPP PP Sbjct: 30 PYYYSSPPPPYEYKSPPPPVKSPPP--PYEYKSPPPPVKSPPP 70 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXX----GPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P + P P PPP PPP P PPP PP Sbjct: 77 PPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPP--PYYYHSPPPPVKSPPP 134 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXX----GPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P + P P PPP PPP P PPP PP Sbjct: 93 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPP--PYYYHSPPPPVKSPPP 150 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXX----GPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P + P P PPP PPP P PPP PP Sbjct: 109 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPP--PYYYHSPPPPVKSPPP 166 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 667 PPXPXATPGXXX----GPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P +P P + P P PPP PPP P PPP PP Sbjct: 141 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPP--PYLYSSPPPPVKSPPP 198 >At2g35920.1 68415.m04409 helicase domain-containing protein similar to DEIH-box RNA/DNA helicase [Arabidopsis thaliana] GI:5881579; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 995 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 821 GAXGGGXXGGX-GXRGGGGXXGGG 753 G GGG G G RGGGG GGG Sbjct: 11 GRRGGGHSSGRRGGRGGGGRGGGG 34 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 744 PRXPPPXXPPPPPXP 788 P PPP PPPPP P Sbjct: 258 PPTPPPPPPPPPPRP 272 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 PP P P P P PP PPPP P P A PP Sbjct: 230 PPTPPL-PKFLVSPASSLGKRDENSSPFAPPTPPPPPPPPPPRPLAKAARAQKSPP 284 Score = 28.3 bits (60), Expect = 7.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 726 RXXGXXPRXPPPXXPPPPPXPXPP 797 R P PP PPPPP P P Sbjct: 249 RDENSSPFAPPTPPPPPPPPPPRP 272 >At1g35880.1 68414.m04457 hypothetical protein Length = 222 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 821 GAXGGGXXGGXGXRGGGGXXGG 756 G GGG GG G + GGG GG Sbjct: 163 GGGGGGNLGGGGGKFGGGGDGG 184 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 347 GGGXGXTXGGXXGXXGGGGXXG 412 GGG G GG G GGGG G Sbjct: 163 GGGGGGNLGGGGGKFGGGGDGG 184 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 796 GGXGXGGGGGXXGGGXRG 743 GG GGGGG GGG G Sbjct: 166 GGGNLGGGGGKFGGGGDG 183 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPP 813 P PPP PP P PP P P Sbjct: 22 PPAPPPESSSPPTPPEPPDPPDP 44 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 754 PPPXXPPPPRXPXPPXXPPPXAPXXP 831 PPP PPP PP P P P P Sbjct: 21 PPPA--PPPESSSPPTPPEPPDPPDP 44 >At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kinase 2 (SERK2) nearly identical to somatic embryogenesis receptor-like kinase 2 [Arabidopsis thaliana] GI:14573457; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain; identical to cDNA somatic embryogenesis receptor-like kinase 2 (SERK2) GI:14573456 Length = 628 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +1 Query: 640 PXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXP 795 P G P A GP RP P G P PPP PPP P P Sbjct: 185 PDNGSFSLFTPISFANNLDLCGPVTS-RPCP-GSPPFSPPPPFIPPPIVPTP 234 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAP 822 P PPP PP P P PPP P Sbjct: 219 PLQPPPPPPPSQPLPRPLLLPPPPPP 244 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 718 QRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPP 813 Q+P P PPP P PR P PPP Sbjct: 213 QQPVLLPLQPPPPPPPSQPLPRPLLLPPPPPP 244 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 760 PXXPPPPRXPXPPXXPPPXAPXXPP 834 P PPPP P P P P PP Sbjct: 219 PLQPPPPPPPSQPLPRPLLLPPPPP 243 >At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 315 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 744 PRXPPPXXPPPPPXP 788 P PPP PPPPP P Sbjct: 234 PPGPPPPPPPPPPSP 248 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 756 PPXXPPPPPXPXP 794 PP PPPPP P P Sbjct: 234 PPGPPPPPPPPPP 246 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 759 PXXPPPPPXPXPP 797 P PPPPP P PP Sbjct: 234 PPGPPPPPPPPPP 246 >At1g09460.1 68414.m01058 glucan endo-1,3-beta-glucosidase-related similar to glucan endo-1,3-beta-glucosidase precursor SP:P52409 from [Triticum aestivum] Length = 330 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P TP P P P PP PPP PP P PP Sbjct: 38 PTNPTTTPTATFPPVTITPTNPATTVPIVPPVTTIPPPTLTPPPVITIPPPTLTPP 93 >At5g28480.1 68418.m03462 hypothetical protein Length = 1230 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXGXP 418 +G + GGP G G G + G G GG G P Sbjct: 422 SGGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGP 457 >At5g07150.1 68418.m00815 leucine-rich repeat family protein contains weak similarity to LRR receptor-like protein kinase [Nicotiana tabacum] gi|7672732|gb|AAF66615; contains Pfam PF00560 domain Leucine Rich Repeat Length = 553 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 757 PPXXPPPPRXPXPPXXPPPXAPXXP 831 P PPPP P P PPP P Sbjct: 193 PSPVPPPPAQPPPAQTPPPQLSEVP 217 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXA 819 P PPP PPP + P P P A Sbjct: 195 PVPPPPAQPPPAQTPPPQLSEVPHA 219 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXG 723 GG G G GG G RG G GG G P G G Sbjct: 37 GGRGGGRGFSDRGGRG-RGRGPPRGGARGGRGPAGRG 72 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 314 GXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXG 412 G G G G GG G GG G GGGG G Sbjct: 11 GFSGGRGRGGYSGGRGD--GGFSGGRGGGGRGG 41 Score = 28.7 bits (61), Expect = 5.7 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = -1 Query: 830 GXXGAXGGGXXGGXGXRGGGGXXGG--GXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GG GG GGG GG G G GR P G G GG Sbjct: 17 GRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRGPAGRGG 73 Score = 28.7 bits (61), Expect = 5.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 313 GXGXGGGPPXXRGGXGXDPXGXXGXXGGGGAXGXPKR 423 G G G GPP G P G G GG P R Sbjct: 50 GRGRGRGPPRGGARGGRGPAGRGGMKGGSKVIVEPHR 86 >At4g20020.2 68417.m02930 expressed protein Length = 406 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP 780 GGGG P ATPG G P G G P PPPP Sbjct: 231 GGGGSYGPQQGYATPGQGQG-TQAPPPFQGGYNQG---PRSPPPP 271 >At4g20020.1 68417.m02931 expressed protein Length = 419 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 646 GGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPP 780 GGGG P ATPG G P G G P PPPP Sbjct: 231 GGGGSYGPQQGYATPGQGQG-TQAPPPFQGGYNQG---PRSPPPP 271 >At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 721 RPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 +P P P P PPPPR P P P P P Sbjct: 35 KPKPV-PSPKPKPVQCPPPPRPSVPSPNPRPVTPPRTP 71 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -1 Query: 833 GGXXGAXGGGXXG--GXGXRGGGGXXGGGXPG 744 GG G G G G G GGGG GGG G Sbjct: 17 GGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGG 48 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGG 768 GG G GG GG G GGGG Sbjct: 28 GGSSGCGAGGGGGGSGGGGGGG 49 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 Query: 793 GXGXGGGGGXXGGGXRGXXPXXRAV 719 G G GGGGG GGG G R++ Sbjct: 32 GCGAGGGGGGSGGGGGGGGDSQRSI 56 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G RP P P PP PPP P PP AP PP Sbjct: 93 GMRP-PVLPRPMMPPQGYMPPP--GVPQMMAPPGAPLPPP 129 Score = 29.1 bits (62), Expect = 4.3 Identities = 23/69 (33%), Positives = 23/69 (33%) Frame = +1 Query: 628 AXXAPXGGGGXXXPPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXP 807 A P G PP PG GP G P P G G PPP PP P Sbjct: 124 APLPPPPQNGILRPPGMAPIPGQGGGPP-GMAPIP-GQGGG------PPPNYNGLPPPPP 175 Query: 808 PPXAPXXPP 834 P PP Sbjct: 176 YHTNPAAPP 184 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVAXGXGG 666 G G GGG GG G G GGG G R+ + G GG Sbjct: 524 GSSSGRSGGGSYGGYGGSSGRSGGGGGSYGGSGGSSSRYSGGSDRSSGFGSFGSGG 579 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGG 403 +G GG G GG G + GG G GG Sbjct: 527 SGRSGGGSYGGYGGSSGRSGGGGGSYGGSGG 557 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 6/59 (10%) Frame = +1 Query: 676 PXATPGXXXGPXXGQRPXPXGXXPGXPPPXX------PPPPRXPXPPXXPPPXAPXXPP 834 P TP P P G P P P PP P PPP P PP Sbjct: 62 PFITPFPNPNPNPNPNPPVLGSSPPSPTDSSSSTSISPNPPAPIVNPNPPPPSTPNPPP 120 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 667 PPXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAP 822 PP P P P P PPPP P PPP AP Sbjct: 101 PPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDI-PIPPPPPAP 151 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 745 PGXPPPXXP-PPPR-XPXPPXXPPPXAPXXP 831 P PPP P PPP P PP AP P Sbjct: 108 PNPPPPSTPNPPPEFSPPPPDLDTTTAPPPP 138 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 745 PGXPPPXXPPPPRXPXPPXXPPPXAPXXP 831 P P P P P P P PP +P P Sbjct: 99 PNPPAPIVNPNPPPPSTPNPPPEFSPPPP 127 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +1 Query: 670 PXPXATPGXXXGPXXGQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 P P +TP P P P PPP P P PP P PP Sbjct: 110 PPPPSTPNP---PPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPP 161 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 715 GQRPXPXGXXPGXPPPXXPPPPRXPXPPXXPPPXAPXXPP 834 G+RP P P P PP P PP P P PP Sbjct: 536 GRRPRPPLPPPARARPLPPPARARPMPP--PARARPLPPP 573 >At2g12100.1 68415.m01300 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At5g28270, At2g05450, At1g45090, At2g16180, At2g06750 Length = 1224 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXGXP 418 +G + GGP G G G + G G GG G P Sbjct: 435 SGGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGP 470 >At1g45090.1 68414.m05169 Ulp1 protease family protein similar to At5g28270, At2g12100, At2g05450, At2g16180, At2g06750; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1210 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 311 AGXEXGGGPXGXGGGXGXTXGGXXGXXGGGGXXGXP 418 +G + GGP G G G + G G GG G P Sbjct: 426 SGGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGP 461 >At1g19960.1 68414.m02501 expressed protein Length = 64 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 809 GGXXGGXGXRGGGGXXGGGXPG 744 GG GG G GGGG G G G Sbjct: 14 GGIAGGSGCNGGGGGSGSGSGG 35 >At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing protein Length = 573 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = -1 Query: 833 GGXXGAXGGGXXGGXGXRGGGGXXGGGXPGXXPXGXGRWPXXGPXLXPGVA-XGXGGXXX 657 GG GG GG G GG GG G GP PG+A GG Sbjct: 327 GGRNYGRGGFARGGQGMGNRGGAWGGAMRGRGVNNMASGSGAGP-YGPGLAGPAFGGMMH 385 Query: 656 PPPPXGA 636 P GA Sbjct: 386 PQGMMGA 392 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.313 0.156 0.564 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,313,871 Number of Sequences: 28952 Number of extensions: 383450 Number of successful extensions: 19089 Number of sequences better than 10.0: 345 Number of HSP's better than 10.0 without gapping: 1191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8854 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2168774904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits)
- SilkBase 1999-2023 -