BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C09 (936 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g47930.1 68418.m05921 40S ribosomal protein S27 (RPS27D) 138 4e-33 At3g61110.1 68416.m06839 40S ribosomal protein S27 (ARS27A) iden... 135 3e-32 At2g45710.1 68415.m05685 40S ribosomal protein S27 (RPS27A) 130 2e-30 At2g44870.1 68415.m05586 expressed protein 30 1.9 At4g21100.1 68417.m03051 UV-damaged DNA-binding protein, putativ... 29 5.9 >At5g47930.1 68418.m05921 40S ribosomal protein S27 (RPS27D) Length = 84 Score = 138 bits (335), Expect = 4e-33 Identities = 59/78 (75%), Positives = 66/78 (84%) Frame = +1 Query: 91 IDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILC 270 IDLLHP P E+RKHKLKRLV PNS+FMDVKC GC+ ITTVFSH+Q VVVC C T+LC Sbjct: 7 IDLLHPPPELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC 66 Query: 271 QPTGGRARLTEGCSFRRK 324 QPTGG+ARL EGCSFR+K Sbjct: 67 QPTGGKARLQEGCSFRKK 84 >At3g61110.1 68416.m06839 40S ribosomal protein S27 (ARS27A) identical to cDNA ribosomal protein S27 (ARS27A) GI:4193381 Length = 86 Score = 135 bits (327), Expect = 3e-32 Identities = 59/78 (75%), Positives = 66/78 (84%) Frame = +1 Query: 91 IDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILC 270 IDLL+P E+RKHKLKRLV PNS+FMDVKC GC+ ITTVFSH+Q VVVC C TILC Sbjct: 7 IDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTILC 66 Query: 271 QPTGGRARLTEGCSFRRK 324 QPTGG+A+LTEGCSFRRK Sbjct: 67 QPTGGKAKLTEGCSFRRK 84 >At2g45710.1 68415.m05685 40S ribosomal protein S27 (RPS27A) Length = 84 Score = 130 bits (313), Expect = 2e-30 Identities = 55/78 (70%), Positives = 65/78 (83%) Frame = +1 Query: 91 IDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILC 270 IDLL+P E+RKHKLKRLV PNS+FMDVKC GC+ ITTVFSH+Q VV+C C T+LC Sbjct: 7 IDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGNCQTLLC 66 Query: 271 QPTGGRARLTEGCSFRRK 324 PTGG+A+LTEGCSFR+K Sbjct: 67 TPTGGKAKLTEGCSFRKK 84 >At2g44870.1 68415.m05586 expressed protein Length = 248 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 163 NSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTG 282 N++ + +CP C + + +++ C GC I+ QP G Sbjct: 175 NNFVIKGECPACKR--QFIGYKNQIIRCEGCGNIVWQPQG 212 >At4g21100.1 68417.m03051 UV-damaged DNA-binding protein, putative similar to UV-damaged DNA binding protein (GI:12082087) [Oryza sativa] and damage-specific DNA binding protein 1, Homo sapiens, PIR2:I38908; contains Pfam PF03178 : CPSF A subunit region Length = 1088 Score = 28.7 bits (61), Expect = 5.9 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 8/84 (9%) Frame = +1 Query: 61 CIKAVTMPLAIDLLHPSPASERRKHKLKRLVPHPN-----SYFMDVKCPGCYKITTVFSH 225 C + T AI L P++E + RL+ + SY +D GC ++ F+ Sbjct: 719 CHQEQTRTFAISCLRNEPSAEESESHFVRLLDAQSFEFLSSYPLDAFECGCSILSCSFTD 778 Query: 226 AQRVVVCAGCSTIL---CQPTGGR 288 + V C G + +L +PT GR Sbjct: 779 DKNVYYCVGTAYVLPEENEPTKGR 802 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,148,753 Number of Sequences: 28952 Number of extensions: 215565 Number of successful extensions: 405 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2236853040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -