BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C02 (904 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) 31 0.96 SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 31 1.3 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 31 1.7 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 31 1.7 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 31 1.7 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 31 1.7 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 31 1.7 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 31 1.7 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 31 1.7 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 31 1.7 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 31 1.7 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 31 1.7 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 31 1.7 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 31 1.7 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 31 1.7 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 31 1.7 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 31 1.7 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 31 1.7 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 31 1.7 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 31 1.7 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 31 1.7 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 31 1.7 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 31 1.7 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 31 1.7 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 31 1.7 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 31 1.7 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 31 1.7 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 31 1.7 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 31 1.7 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 31 1.7 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 31 1.7 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 31 1.7 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 31 1.7 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 31 1.7 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 31 1.7 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 31 1.7 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 31 1.7 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 31 1.7 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 31 1.7 SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 31 1.7 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 31 1.7 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 31 1.7 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 31 1.7 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 31 1.7 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 31 1.7 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 31 1.7 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 31 1.7 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 31 1.7 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 31 1.7 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 31 1.7 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 31 1.7 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 31 1.7 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 31 1.7 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 31 1.7 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 31 1.7 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 31 1.7 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 31 1.7 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 31 1.7 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 31 1.7 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 31 1.7 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 31 1.7 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 31 1.7 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 31 1.7 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 31 1.7 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 31 1.7 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 31 1.7 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 31 1.7 SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 31 1.7 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 31 1.7 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 31 1.7 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 31 1.7 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 31 1.7 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 31 1.7 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 31 1.7 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 31 1.7 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 31 1.7 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 31 1.7 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 31 1.7 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_57198| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 31 1.7 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54385| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 31 1.7 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 31 1.7 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 31 1.7 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 31 1.7 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51677| Best HMM Match : DUF327 (HMM E-Value=0.89) 31 1.7 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50879| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50740| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50212| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 31 1.7 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49154| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 31 1.7 SB_46319| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 31 1.7 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 31 1.7 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 31 1.7 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 31 1.7 SB_45133| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44633| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 31 1.7 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42693| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 31 1.7 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40779| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 31 1.7 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 31 1.7 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 31 1.7 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 31 1.7 SB_39135| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 31 1.7 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 31 1.7 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 31 1.7 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 31 1.7 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 31 1.7 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 31 1.7 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 31 1.7 SB_36097| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 31 1.7 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34891| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 31 1.7 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34301| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 31 1.7 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_33876| Best HMM Match : EGF (HMM E-Value=2.4e-08) 31 1.7 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 31 1.7 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 31 1.7 SB_32717| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 31 1.7 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 31 1.7 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29247| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_29112| Best HMM Match : Mucin (HMM E-Value=1.7) 31 1.7 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 31 1.7 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_26774| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 31 1.7 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_26142| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 31 1.7 SB_25656| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24739| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24686| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24558| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_22776| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 31 1.7 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_22655| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 >SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) Length = 300 Score = 31.5 bits (68), Expect = 0.96 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 591 CIHXMFQVQGEVWEVXSAXXNRPTXGERXFXYW 689 C + QV V V +A NRPT GER F YW Sbjct: 189 CCTTLLQVGKPV--VPAALMNRPTRGERRFAYW 219 >SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 31.5 bits (68), Expect = 0.96 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 630 EVXSAXXNRPTXGERXFXYW 689 +V +A NRPT GER F YW Sbjct: 5 DVPAALMNRPTRGERRFAYW 24 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +3 Query: 567 NKQXXXXXCIHXMFQVQG-EVWE--VXSAXXNRPTXGERXFXYW 689 N Q +H +F +G V + V +A NRPT GER F YW Sbjct: 161 NDQIISGLRLHNLFYRKGIRVGKPVVPAALMNRPTRGERRFAYW 204 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = +3 Query: 606 FQVQGEVWEVXSAXXNRPTXGERXFXYW 689 FQV V V +A NRPT GER F YW Sbjct: 113 FQVGKPV--VPAALMNRPTRGERRFAYW 138 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 43 VPAALMNRPTRGERRFAYW 61 >SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 114 VPAALMNRPTRGERRFAYW 132 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 71 VPAALMNRPTRGERRFAYW 89 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 119 VPAALMNRPTRGERRFAYW 137 >SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 80 VPAALMNRPTRGERRFAYW 98 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 118 VPAALMNRPTRGERRFAYW 136 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 43 VPAALMNRPTRGERRFAYW 61 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 140 VPAALMNRPTRGERRFAYW 158 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 242 VPAALMNRPTRGERRFAYW 260 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 62 VPAALMNRPTRGERRFAYW 80 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 80 VPAALMNRPTRGERRFAYW 98 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 67 VPAALMNRPTRGERRFAYW 85 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 138 VPAALMNRPTRGERRFAYW 156 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 92 VPAALMNRPTRGERRFAYW 110 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 56 VPAALMNRPTRGERRFAYW 74 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 152 VPAALMNRPTRGERRFAYW 170 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 49 VPAALMNRPTRGERRFAYW 67 >SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 50 VPAALMNRPTRGERRFAYW 68 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 79 VPAALMNRPTRGERRFAYW 97 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 197 VPAALMNRPTRGERRFAYW 215 >SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 39 VPAALMNRPTRGERRFAYW 57 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 38 VPAALMNRPTRGERRFAYW 56 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 339 VPAALMNRPTRGERRFAYW 357 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 194 VPAALMNRPTRGERRFAYW 212 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 94 VPAALMNRPTRGERRFAYW 112 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 80 VPAALMNRPTRGERRFAYW 98 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 557 VPAALMNRPTRGERRFAYW 575 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 269 VPAALMNRPTRGERRFAYW 287 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 313 VPAALMNRPTRGERRFAYW 331 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 43 VPAALMNRPTRGERRFAYW 61 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 156 VPAALMNRPTRGERRFAYW 174 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 114 VPAALMNRPTRGERRFAYW 132 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 78 VPAALMNRPTRGERRFAYW 96 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 40 VPAALMNRPTRGERRFAYW 58 >SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) Length = 99 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 50 VPAALMNRPTRGERRFAYW 68 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 79 VPAALMNRPTRGERRFAYW 97 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 474 VPAALMNRPTRGERRFAYW 492 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 71 VPAALMNRPTRGERRFAYW 89 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 34 VPAALMNRPTRGERRFAYW 52 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 125 VPAALMNRPTRGERRFAYW 143 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 48 VPAALMNRPTRGERRFAYW 66 >SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 62 VPAALMNRPTRGERRFAYW 80 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 83 VPAALMNRPTRGERRFAYW 101 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 5503 VPAALMNRPTRGERRFAYW 5521 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 99 VPAALMNRPTRGERRFAYW 117 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 9 VPAALMNRPTRGERRFAYW 27 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 59 VPAALMNRPTRGERRFAYW 77 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 546 VPAALMNRPTRGERRFAYW 564 >SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 45 VPAALMNRPTRGERRFAYW 63 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 160 VPAALMNRPTRGERRFAYW 178 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 59 VPAALMNRPTRGERRFAYW 77 >SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) Length = 711 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 646 VPAALMNRPTRGERRFAYW 664 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 117 VPAALMNRPTRGERRFAYW 135 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 43 VPAALMNRPTRGERRFAYW 61 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 167 VPAALMNRPTRGERRFAYW 185 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 42 VPAALMNRPTRGERRFAYW 60 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 63 VPAALMNRPTRGERRFAYW 81 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 85 VPAALMNRPTRGERRFAYW 103 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 62 VPAALMNRPTRGERRFAYW 80 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 92 VPAALMNRPTRGERRFAYW 110 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 51 VPAALMNRPTRGERRFAYW 69 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 52 VPAALMNRPTRGERRFAYW 70 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 62 VPAALMNRPTRGERRFAYW 80 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 78 VPAALMNRPTRGERRFAYW 96 >SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) Length = 490 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 355 VPAALMNRPTRGERRFAYW 373 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 76 VPAALMNRPTRGERRFAYW 94 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 45 VPAALMNRPTRGERRFAYW 63 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 183 VPAALMNRPTRGERRFAYW 201 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 574 VPAALMNRPTRGERRFAYW 592 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 296 VPAALMNRPTRGERRFAYW 314 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 43 VPAALMNRPTRGERRFAYW 61 >SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 69 VPAALMNRPTRGERRFAYW 87 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 800 VPAALMNRPTRGERRFAYW 818 >SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) Length = 917 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 579 VPAALMNRPTRGERRFAYW 597 >SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) Length = 709 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 135 VPAALMNRPTRGERRFAYW 153 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 185 VPAALMNRPTRGERRFAYW 203 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 84 VPAALMNRPTRGERRFAYW 102 >SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 214 VPAALMNRPTRGERRFAYW 232 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 485 VPAALMNRPTRGERRFAYW 503 >SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 30 VPAALMNRPTRGERRFAYW 48 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 143 VPAALMNRPTRGERRFAYW 161 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 140 VPAALMNRPTRGERRFAYW 158 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 930 VPAALMNRPTRGERRFAYW 948 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 56 VPAALMNRPTRGERRFAYW 74 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 98 VPAALMNRPTRGERRFAYW 116 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 435 VPAALMNRPTRGERRFAYW 453 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 39 VPAALMNRPTRGERRFAYW 57 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 42 VPAALMNRPTRGERRFAYW 60 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 68 VPAALMNRPTRGERRFAYW 86 >SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 471 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 422 VPAALMNRPTRGERRFAYW 440 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 231 VPAALMNRPTRGERRFAYW 249 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 238 VPAALMNRPTRGERRFAYW 256 >SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) Length = 247 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 198 VPAALMNRPTRGERRFAYW 216 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 141 VPAALMNRPTRGERRFAYW 159 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 34 VPAALMNRPTRGERRFAYW 52 >SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 38 VPAALMNRPTRGERRFAYW 56 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 750 VPAALMNRPTRGERRFAYW 768 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 43 VPAALMNRPTRGERRFAYW 61 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 50 VPAALMNRPTRGERRFAYW 68 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) Length = 110 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 61 VPAALMNRPTRGERRFAYW 79 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 20 VPAALMNRPTRGERRFAYW 38 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 115 VPAALMNRPTRGERRFAYW 133 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 140 VPAALMNRPTRGERRFAYW 158 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 101 VPAALMNRPTRGERRFAYW 119 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 225 VPAALMNRPTRGERRFAYW 243 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 51 VPAALMNRPTRGERRFAYW 69 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 99 VPAALMNRPTRGERRFAYW 117 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 134 VPAALMNRPTRGERRFAYW 152 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 59 VPAALMNRPTRGERRFAYW 77 >SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) Length = 225 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 176 VPAALMNRPTRGERRFAYW 194 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 1679 VPAALMNRPTRGERRFAYW 1697 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 101 VPAALMNRPTRGERRFAYW 119 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 69 VPAALMNRPTRGERRFAYW 87 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) Length = 409 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 113 VPAALMNRPTRGERRFAYW 131 >SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 71 VPAALMNRPTRGERRFAYW 89 >SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 99 VPAALMNRPTRGERRFAYW 117 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 38 VPAALMNRPTRGERRFAYW 56 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 78 VPAALMNRPTRGERRFAYW 96 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 47 VPAALMNRPTRGERRFAYW 65 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 941 VPAALMNRPTRGERRFAYW 959 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 88 VPAALMNRPTRGERRFAYW 106 >SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) Length = 134 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 85 VPAALMNRPTRGERRFAYW 103 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 421 VPAALMNRPTRGERRFAYW 439 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 51 VPAALMNRPTRGERRFAYW 69 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 103 VPAALMNRPTRGERRFAYW 121 >SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) Length = 230 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 181 VPAALMNRPTRGERRFAYW 199 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 469 VPAALMNRPTRGERRFAYW 487 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 76 VPAALMNRPTRGERRFAYW 94 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 467 VPAALMNRPTRGERRFAYW 485 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 89 VPAALMNRPTRGERRFAYW 107 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 47 VPAALMNRPTRGERRFAYW 65 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 47 VPAALMNRPTRGERRFAYW 65 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 45 VPAALMNRPTRGERRFAYW 63 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 91 VPAALMNRPTRGERRFAYW 109 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 98 VPAALMNRPTRGERRFAYW 116 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 237 VPAALMNRPTRGERRFAYW 255 >SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) Length = 197 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 148 VPAALMNRPTRGERRFAYW 166 >SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 75 VPAALMNRPTRGERRFAYW 93 >SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 117 VPAALMNRPTRGERRFAYW 135 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 1152 VPAALMNRPTRGERRFAYW 1170 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 48 VPAALMNRPTRGERRFAYW 66 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 68 VPAALMNRPTRGERRFAYW 86 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 53 VPAALMNRPTRGERRFAYW 71 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 46 VPAALMNRPTRGERRFAYW 64 >SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 76 VPAALMNRPTRGERRFAYW 94 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 67 VPAALMNRPTRGERRFAYW 85 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 44 VPAALMNRPTRGERRFAYW 62 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 1422 VPAALMNRPTRGERRFAYW 1440 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 575 VPAALMNRPTRGERRFAYW 593 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 35 VPAALMNRPTRGERRFAYW 53 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 272 VPAALMNRPTRGERRFAYW 290 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 484 VPAALMNRPTRGERRFAYW 502 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 37 VPAALMNRPTRGERRFAYW 55 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 106 VPAALMNRPTRGERRFAYW 124 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 90 VPAALMNRPTRGERRFAYW 108 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 90 VPAALMNRPTRGERRFAYW 108 >SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 68 VPAALMNRPTRGERRFAYW 86 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 128 VPAALMNRPTRGERRFAYW 146 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 58 VPAALMNRPTRGERRFAYW 76 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 100 VPAALMNRPTRGERRFAYW 118 >SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 39 VPAALMNRPTRGERRFAYW 57 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 138 VPAALMNRPTRGERRFAYW 156 >SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 55 VPAALMNRPTRGERRFAYW 73 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 65 VPAALMNRPTRGERRFAYW 83 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 61 VPAALMNRPTRGERRFAYW 79 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 491 VPAALMNRPTRGERRFAYW 509 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 386 VPAALMNRPTRGERRFAYW 404 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 39 VPAALMNRPTRGERRFAYW 57 >SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 23 VPAALMNRPTRGERRFAYW 41 >SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 173 VPAALMNRPTRGERRFAYW 191 >SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 58 VPAALMNRPTRGERRFAYW 76 >SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_57198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 20 VPAALMNRPTRGERRFAYW 38 >SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 50 VPAALMNRPTRGERRFAYW 68 >SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 41 VPAALMNRPTRGERRFAYW 59 >SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 196 VPAALMNRPTRGERRFAYW 214 >SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 50 VPAALMNRPTRGERRFAYW 68 >SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) Length = 458 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 >SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 633 VXSAXXNRPTXGERXFXYW 689 V +A NRPT GER F YW Sbjct: 6 VPAALMNRPTRGERRFAYW 24 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,831,011 Number of Sequences: 59808 Number of extensions: 133136 Number of successful extensions: 795 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2597949818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -