BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_C01 (889 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 23 2.4 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 23 2.4 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 4.2 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 321 KSSCGIYTGIHALF 362 K C +YT IH LF Sbjct: 11 KDPCDVYTAIHPLF 24 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 321 KSSCGIYTGIHALF 362 K C +YT IH LF Sbjct: 11 KDPCDVYTAIHPLF 24 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 4.2 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = -3 Query: 566 RHSTGEVFFYSXGXGNVSXQLTWAKFHQGTS 474 RHS V G S W KF +GT+ Sbjct: 244 RHSKQNVALLCPAQGFPSPSFRWYKFVEGTT 274 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,440 Number of Sequences: 336 Number of extensions: 2675 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24617054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -