BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B20 (924 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_27872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1021 Score = 29.1 bits (62), Expect = 5.3 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = +2 Query: 221 YEXAIAKCSEYLKEK--KGEVIKEAVKRLIENGKRNTMDFAYQLWTKDGKEIVKSYFP 388 Y I K E+ KEK KG+ K R E GKR A +D E +K +FP Sbjct: 261 YPSLIDKLQEHEKEKELKGKRKKSKTSRSPEKGKREEEKDALLKQEEDEIERMKQFFP 318 >SB_27872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 251 YLKEKKGEVIKEAVKRLIENGKRNTMDFAY 340 + +E+ GE EA KRLI+ GK+ M Y Sbjct: 676 FREEEDGESFAEAKKRLIKQGKQQIMFLLY 705 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,886,398 Number of Sequences: 59808 Number of extensions: 353583 Number of successful extensions: 902 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2681370225 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -