BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B20 (924 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g05170.1 68415.m00544 vacuolar protein sorting 11 family prot... 31 1.4 At5g49160.1 68418.m06085 DNA (cytosine-5-)-methyltransferase (AT... 29 5.8 At4g13290.1 68417.m02078 cytochrome P450 71A19, putative (CYP71A... 29 5.8 >At2g05170.1 68415.m00544 vacuolar protein sorting 11 family protein / VPS11 family protein similar to Vacuolar protein sorting 11 (hVPS11) (PP3476) (Swiss-Prot:Q9H270) [Homo sapiens]; similar to Vacuolar biogenesis protein END1 (PEP5 protein) (Vacuolar protein sorting 11) (Swiss-Prot:P12868) [Saccharomyces cerevisiae] Length = 932 Score = 30.7 bits (66), Expect = 1.4 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 4/85 (4%) Frame = +2 Query: 212 IGEYEXAIAKCSEYLKEKKGEVIKEAVKRLIENGKRNTMDFAYQLWTKDG--KEIVKSYF 385 +G Y+ A+ S + G I++ K LIE+ + T+D +L T+ G + S Sbjct: 498 LGNYDEALQYVSSLEPSQAGVTIEQYGKILIEHKPKETIDILMRLCTEQGIPNGVFLSML 557 Query: 386 --PIQFRVIFTEQTVXLINKRDHHA 454 P+ F +F + L++ + +A Sbjct: 558 PSPVDFITVFVQHPHSLMHFLERYA 582 >At5g49160.1 68418.m06085 DNA (cytosine-5-)-methyltransferase (ATHIM) identical to SP|P34881 DNA (cytosine-5)-methyltransferase AthI (EC 2.1.1.37) {Arabidopsis thaliana} Length = 1534 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 356 PLSITGRRSPWCSSCRFRSDASR 288 PLS GR S +C+SC+ R D + Sbjct: 869 PLSDIGRSSGFCTSCKIREDEEK 891 >At4g13290.1 68417.m02078 cytochrome P450 71A19, putative (CYP71A19) Identical to Cytochrome P450 (SP:Q9T0K0) [Arabidopsis thaliana]; similar to cytochrome P450LXXIA1, Persea americana, M32885 Length = 490 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 454 GVMVPFVYELDSLLGEDHSKLDGEVRFDDFL 362 G +P + +D + G+DH + + RFD+FL Sbjct: 221 GEYIPSLSWIDKIRGQDHKMEEVDKRFDEFL 251 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,854,085 Number of Sequences: 28952 Number of extensions: 250341 Number of successful extensions: 692 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 691 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2197951248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -