BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B18 (801 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0686 - 30900748-30902167,30903442-30904742 31 1.1 04_03_0799 - 19805190-19805749,19806316-19806403 29 3.3 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 29 5.7 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 29 5.7 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 28 9.9 07_01_0439 + 3333654-3334217 28 9.9 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 661 PPPKXXKKKKXXXXXXXXXPPPXXKXXPXPPPP 759 PPP K PPP K P PPPP Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPP 359 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 661 PPPKXXKKKKXXXXXXXXXPPPXXKXXPXPPPP 759 PPPK PPP P PPPP Sbjct: 317 PPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 661 PPPKXXKKKKXXXXXXXXXPPPXXKXXPXPPPP 759 PPP K PPP P PPPP Sbjct: 326 PPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPP 358 >04_03_0799 - 19805190-19805749,19806316-19806403 Length = 215 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 662 PPPKXXKKKKXXXXXXXXXXP-PXXXXXPPPPP 757 PPPK +KKK P P PPPPP Sbjct: 80 PPPKEPEKKKKDEKPVCKLVPFPVPYPAPPPPP 112 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 655 GXPPPKXXKKKKXXXXXXXXXPPPXXKXXPXPPPP 759 G PPP PPP P PPPP Sbjct: 218 GAPPPPPPPPPSPHRHPAAHPPPPPHHPAPRPPPP 252 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +2 Query: 662 PPPKXXKKKKXXXXXXXXXXPPXXXXXPPPPPP 760 PPP +++ PP PPPPPP Sbjct: 375 PPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPP 407 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/33 (33%), Positives = 12/33 (36%) Frame = +2 Query: 662 PPPKXXKKKKXXXXXXXXXXPPXXXXXPPPPPP 760 PPP + PP PPPPPP Sbjct: 96 PPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPP 128 >07_01_0439 + 3333654-3334217 Length = 187 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/33 (33%), Positives = 13/33 (39%) Frame = +2 Query: 662 PPPKXXKKKKXXXXXXXXXXPPXXXXXPPPPPP 760 PPP K++ P PPPPPP Sbjct: 9 PPPSSKGKRRPGGIIRGPRPQPLIVSPPPPPPP 41 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.314 0.140 0.428 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,063,791 Number of Sequences: 37544 Number of extensions: 229482 Number of successful extensions: 4547 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3495 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2174172540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -