BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B16 (910 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 27 2.8 SPBPB2B2.18 |||dubious|Schizosaccharomyces pombe|chr 2|||Manual 26 6.4 SPBC31F10.13c |hip1|hir1|hira protein Hip1|Schizosaccharomyces p... 26 6.4 SPAC30C2.06c |dml1||mitochondrial genome maintenance protein |Sc... 26 6.4 SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharo... 26 8.5 >SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 27.5 bits (58), Expect = 2.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 537 LGGRTDSRTHKDSCERRQN*PRHGRC 614 L G+T + H +SC R++ RHG C Sbjct: 49 LDGKTLEKQHCESCSIREDSSRHGIC 74 >SPBPB2B2.18 |||dubious|Schizosaccharomyces pombe|chr 2|||Manual Length = 175 Score = 26.2 bits (55), Expect = 6.4 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 635 SRGHWHVPFNASETEEKDFHVDEKTTIK 718 S+ WH P N E++ H D+ TIK Sbjct: 62 SQCDWHEPANVYSIEQRRSHDDDLPTIK 89 >SPBC31F10.13c |hip1|hir1|hira protein Hip1|Schizosaccharomyces pombe|chr 2|||Manual Length = 932 Score = 26.2 bits (55), Expect = 6.4 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 478 SEVDNINFSAPKNAADIINRWADEQTQG-HIKTPVSEDKIDPATAVAMFN 624 + + NINF AP+ +I++ +EQ +K SE +P VA+ N Sbjct: 578 TSISNINFEAPRYKTNIVHSLNNEQKYVLEVKNGTSEK--NPTRIVALEN 625 >SPAC30C2.06c |dml1||mitochondrial genome maintenance protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 465 Score = 26.2 bits (55), Expect = 6.4 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 400 TVANKIYVSDQYKLADAFSRTANLFRSEVDNINFSAPKNAADIINRWA 543 T+ ++Y S Y++ D S+ + R + N+NF A KN + WA Sbjct: 303 TLPTRVYGSSCYRMKDIESKLQSEGRGFIHNLNFKA-KNYSS--KEWA 347 >SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 25.8 bits (54), Expect = 8.5 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 27 TREFLKILSRSATVMDRLLLLVTLVCGTQAFYMFGHEFS 143 T F ++L + +L L TL+C Q FY F ++ + Sbjct: 658 TSAFDEVLKYFNELSGKLALEPTLICAEQCFYQFKNKLA 696 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,517,484 Number of Sequences: 5004 Number of extensions: 70256 Number of successful extensions: 177 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 177 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 460503700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -