BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B15 (911 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 25 4.2 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 24 5.6 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 24.6 bits (51), Expect = 4.2 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -2 Query: 223 LGVVFDX-LEEVGSGAAHQRXLGQSDAGEENY 131 +G+ D LEE+G+ + LG DA E+Y Sbjct: 187 VGIYVDKRLEELGANRVFELGLGDDDANIEDY 218 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 24.2 bits (50), Expect = 5.6 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -3 Query: 165 PWARAMQAKRTTNLAAMMYXRETECGGDANRTANTEE 55 PW A + ++++A+ T GDA A+ +E Sbjct: 807 PWHSAATVRSVSHVSAVTIMSRTHAPGDAPHIADVKE 843 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 571,056 Number of Sequences: 2352 Number of extensions: 7822 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 98814789 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -