BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B14 (896 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.71 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 24 1.6 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 5.0 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 25.4 bits (53), Expect = 0.71 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 130 WRQTAFCFYKVRRATTKNTEKEETGL 53 W Q FC+++ AT KN + L Sbjct: 533 WFQNTFCYFRRNAATWKNAVRHNLSL 558 Score = 22.6 bits (46), Expect = 5.0 Identities = 7/18 (38%), Positives = 15/18 (83%) Frame = -2 Query: 529 FLKVNSLESEEQQERHHK 476 F++ +SL ++QQ++HH+ Sbjct: 91 FMQQHSLYLQQQQQQHHQ 108 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 24.2 bits (50), Expect = 1.6 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = -2 Query: 493 QERHHKTEQTHSLRPRRNPEWRMRTT 416 ++R H++ T + + P+W R+T Sbjct: 596 EKREHRSSSTKGITIQEPPQWHTRST 621 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.6 bits (46), Expect = 5.0 Identities = 7/37 (18%), Positives = 19/37 (51%) Frame = -2 Query: 520 VNSLESEEQQERHHKTEQTHSLRPRRNPEWRMRTTAA 410 +N+ + ++QQ++ + +Q + ++ W M A Sbjct: 435 INAQQPQQQQQQQQQQQQQQQQQQQQQQHWPMEEEPA 471 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,547 Number of Sequences: 438 Number of extensions: 4172 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29025360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -