BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B13 (895 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53106| Best HMM Match : PLAT (HMM E-Value=0) 31 0.95 SB_44862| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 31 1.7 SB_35536| Best HMM Match : zf-C2H2 (HMM E-Value=0.0069) 30 2.2 SB_13046| Best HMM Match : La (HMM E-Value=5e-23) 30 2.2 SB_3185| Best HMM Match : Sec63 (HMM E-Value=0) 30 2.2 SB_45456| Best HMM Match : DUF963 (HMM E-Value=0.00083) 29 5.1 SB_17610| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_26008| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) 28 8.9 SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 8.9 SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_53106| Best HMM Match : PLAT (HMM E-Value=0) Length = 1790 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/47 (40%), Positives = 25/47 (53%) Frame = +1 Query: 259 LTKSKDAQDFXQGLEGRLRVRAATAQRLRQESPGXRSETRTARPRRL 399 L ++KDA F QG R R+RA +LR G + R +RPR L Sbjct: 1090 LGENKDAMHFQQGQTDRFRIRAKDVGKLRTFRVG--HDNRGSRPRWL 1134 >SB_44862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/50 (34%), Positives = 22/50 (44%) Frame = -2 Query: 444 GAPRPCARCSASTVPKPPWPCRSRLRALPWRLLAKALSCCSTDSEPSFQA 295 G PC+RC + P P R + WR LA ALS +T + A Sbjct: 95 GQNNPCSRCGLLSCPTTTSP-EKRRKTPSWRTLAPALSPSATQPAACYDA 143 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 8/79 (10%) Frame = +1 Query: 463 VEKNATALREKLQAAVQNTVQESQKLAKKV--------SSNVQETNEKLAPKIKAAYDDF 618 VEK A L+EK Q + V + ++ +K S ++ETN L K ++ + Sbjct: 561 VEKKAKELKEKYQGELNEKVNKVERTLRKQYEEDIVKGRSELEETNRTLKEKYESEVSEI 620 Query: 619 AKNTQEVIXKIQEAANAKQ 675 ++V + QE A+Q Sbjct: 621 MLQMEQVQQRNQEVFEAQQ 639 >SB_35536| Best HMM Match : zf-C2H2 (HMM E-Value=0.0069) Length = 657 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/65 (24%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Frame = +1 Query: 466 EKNATALREKLQAAVQNTVQ-ESQKLAKKVSSNVQETNEKLAPKIKAAYDDFAKNTQEVI 642 E+ AL EK + T+Q E +K +K+ + ++ET E + ++++ + + + T+++ Sbjct: 225 EEKLNALLEKEKIVEMTTLQLEDEK--EKIKNELEETKELMQAELESQAETYTEQTRKMH 282 Query: 643 XKIQE 657 ++QE Sbjct: 283 SELQE 287 >SB_13046| Best HMM Match : La (HMM E-Value=5e-23) Length = 442 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +1 Query: 484 LREKLQAAVQNTVQESQKLAKKVSSNVQETNEKLAPKIKAAYDDFAKNTQEVIXKI 651 L+E+ ++ + +Q+ +K K+ S Q+T APK K A TQ KI Sbjct: 340 LKEEYKSLQRQAMQDLKKQLKQTSEAQQQTETNSAPKAKPAKPSVPSPTQTAPNKI 395 >SB_3185| Best HMM Match : Sec63 (HMM E-Value=0) Length = 2590 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = +1 Query: 466 EKNATALREKLQAAVQNTVQESQKLAKKVSSNVQETNEKLAPKIKAAYDDFAKNTQ 633 EKN L E +A+QNT+Q + + E A KI+A + K T+ Sbjct: 272 EKNGIFLSEDSYSAMQNTIQSQTSRITHFETRLPEMEADFAAKIEAMEAELQKVTE 327 >SB_45456| Best HMM Match : DUF963 (HMM E-Value=0.00083) Length = 337 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 5/52 (9%) Frame = -2 Query: 444 GAPRPCARCSASTVPKPPWPCR-----SRLRALPWRLLAKALSCCSTDSEPS 304 G P P C +P PP C+ S L A + + +L C +D PS Sbjct: 123 GIPSPLVACKFDDIPSPPVACKFDDIPSTLVACEFDGIPSSLVTCESDGIPS 174 >SB_17610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 432 PCARCSASTVPKPPWPCRSRLRALPWRLLAKALSCCSTDSE 310 P +RC + P P + R + L WR LA ALS +T + Sbjct: 54 PWSRCGLLSCPTTTSPAKRR-KTLSWRTLAPALSPSATQPD 93 >SB_26008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 28.7 bits (61), Expect = 6.7 Identities = 20/67 (29%), Positives = 35/67 (52%) Frame = +1 Query: 475 ATALREKLQAAVQNTVQESQKLAKKVSSNVQETNEKLAPKIKAAYDDFAKNTQEVIXKIQ 654 A +++ QA + T E+QKL + +++ QETNE + K + +KNTQ+ + Sbjct: 72 AEKIKQLEQALKEKTHNETQKLDRILATCHQETNEVINSK---SISHESKNTQKRSPTLT 128 Query: 655 EAANAKQ 675 + KQ Sbjct: 129 MTEHCKQ 135 >SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2480 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = +1 Query: 520 VQESQKLAKKVSSNVQETNEKLAPKIKAAYDDFAKNTQEVIXKIQEAA 663 VQE++K ++ + V ETN+++ + K + K+ EV K+ E A Sbjct: 1335 VQETKKEVQETKTKVDETNKEV-QETKKEIQETKKDVHEVKGKVSEMA 1381 >SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) Length = 765 Score = 28.3 bits (60), Expect = 8.9 Identities = 21/67 (31%), Positives = 29/67 (43%) Frame = +2 Query: 83 SSALSLSTAHHGRQVRSSLRLHRSGPRSDGATRRSRLLQGHRTPHQGVP*DFXNNSLTRS 262 S + S S +H + RS R P+ + RRSR Q R+P + S R Sbjct: 214 SRSRSRSRSHRKSRKRSESRSRSRSPKKSRSARRSRSPQKSRSPQR----SRSPRSSKRY 269 Query: 263 PSQRTHR 283 S R+HR Sbjct: 270 RSSRSHR 276 >SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1296 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/74 (24%), Positives = 38/74 (51%) Frame = +1 Query: 478 TALREKLQAAVQNTVQESQKLAKKVSSNVQETNEKLAPKIKAAYDDFAKNTQEVIXKIQE 657 TA + K ++ Q+ ++ A+KV S QET+ + +DD +++ +I + + Sbjct: 362 TAKKRKKRSKWIGRRQKVKRRARKVPSGCQETSSSIINGNDEEFDDENMHSETIITE-NQ 420 Query: 658 AANAKQ*ASILNSH 699 N + +SI+N + Sbjct: 421 TINEETSSSIINGN 434 >SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2208 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/61 (26%), Positives = 33/61 (54%) Frame = +1 Query: 472 NATALREKLQAAVQNTVQESQKLAKKVSSNVQETNEKLAPKIKAAYDDFAKNTQEVIXKI 651 +ATA +E+L++AV+ + KL K+S+ ET K A Y+ + ++ + ++ Sbjct: 964 DATASKEELESAVEEKAKAETKLKVKISA--LETKLKKAVNETKRYESSSSQLKQQVKEL 1021 Query: 652 Q 654 + Sbjct: 1022 E 1022 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,763,685 Number of Sequences: 59808 Number of extensions: 268835 Number of successful extensions: 937 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 936 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2562198215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -