BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B10 (902 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22181-7|CAA80189.2| 62|Caenorhabditis elegans Hypothetical pr... 32 0.49 Z32683-16|CAA83631.1| 1061|Caenorhabditis elegans Hypothetical p... 30 2.6 Z32680-6|CAA83602.1| 1061|Caenorhabditis elegans Hypothetical pr... 30 2.6 >Z22181-7|CAA80189.2| 62|Caenorhabditis elegans Hypothetical protein ZK632.9 protein. Length = 62 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 228 GGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNAEHNKK 341 G +RTK + EH + P G +RK+V N E +K Sbjct: 23 GSGKRTKSDRVEHKHASQPGGDTRKVVQTASNGEAKRK 60 >Z32683-16|CAA83631.1| 1061|Caenorhabditis elegans Hypothetical protein C28A5.6 protein. Length = 1061 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/71 (25%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Frame = +3 Query: 159 SEAFFD-EYDYYNFDHDKHIFTGHGGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNAEHN 335 S+ F D + D + H+ + G+ KKE+ + T+ +PS T+ N E + Sbjct: 139 SDCFSDKDLDAVSASSSSHLISEEDGEVGEKKESEQPTDMVEPSSAPTTEETETENEEED 198 Query: 336 KKTSNTKH*MD 368 K K +D Sbjct: 199 DKEKTDKEKLD 209 >Z32680-6|CAA83602.1| 1061|Caenorhabditis elegans Hypothetical protein C28A5.6 protein. Length = 1061 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/71 (25%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Frame = +3 Query: 159 SEAFFD-EYDYYNFDHDKHIFTGHGGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNAEHN 335 S+ F D + D + H+ + G+ KKE+ + T+ +PS T+ N E + Sbjct: 139 SDCFSDKDLDAVSASSSSHLISEEDGEVGEKKESEQPTDMVEPSSAPTTEETETENEEED 198 Query: 336 KKTSNTKH*MD 368 K K +D Sbjct: 199 DKEKTDKEKLD 209 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,170,225 Number of Sequences: 27780 Number of extensions: 330077 Number of successful extensions: 903 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 903 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2297313942 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -