BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B06 (900 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 28 0.13 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 28 0.13 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.9 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 23 3.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 3.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 3.8 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 23 3.8 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 6.6 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 6.6 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 6.6 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 6.6 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 6.6 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 6.6 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 6.6 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 6.6 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 6.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 6.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 8.8 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 27.9 bits (59), Expect = 0.13 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -1 Query: 435 KSSASLAFRALQVHFPHRPS*SSSGLLEL 349 +S+ + ALQ+++PH P SSS ++EL Sbjct: 258 ESNIASVLHALQLYYPHVPEYSSSIIMEL 286 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 27.9 bits (59), Expect = 0.13 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -1 Query: 435 KSSASLAFRALQVHFPHRPS*SSSGLLEL 349 +S+ + ALQ+++PH P SSS ++EL Sbjct: 273 ESNIASVLHALQLYYPHVPEYSSSIIMEL 301 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.4 bits (48), Expect = 2.9 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +1 Query: 268 DPYVIRYPRRKRTVTLLRRARS 333 DP V YPRRK + L RARS Sbjct: 718 DPCVRYYPRRKEWL-YLHRARS 738 Score = 22.2 bits (45), Expect = 6.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 435 KSSASLAFRALQVHFPH 385 KSSA ++ Q HFPH Sbjct: 904 KSSAQSLLQSNQQHFPH 920 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.0 bits (47), Expect = 3.8 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = +1 Query: 187 HGRRLTEKI*TRKRQCRHLR*YVASVRDPYVIRYPRRKRTVTL 315 HG + +I K +C H++ + + P V+ P TL Sbjct: 158 HGTDIEMRILKTKNECDHVQFLITNTSGPGVVSNPMIAELETL 200 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.0 bits (47), Expect = 3.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 585 PLPFQGPPPG 556 P P QGPPPG Sbjct: 40 PNPSQGPPPG 49 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 595 SSRAPALSGSSPRPVSRSLYELAMSG 518 S+ A + + +SPRP S + L +SG Sbjct: 831 SAAATSSTSTSPRPASSTAATLVLSG 856 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.0 bits (47), Expect = 3.8 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = +1 Query: 187 HGRRLTEKI*TRKRQCRHLR*YVASVRDPYVIRYPRRKRTVTL 315 HG + +I K +C H++ + + P V+ P TL Sbjct: 158 HGTDIEMRILKTKNECDHVQFLITNTSGPGVVSNPMIAELETL 200 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 101 PRPIMVRPWVPMRGQVPG 118 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 101 PRPIMVRPWVPMRGQVPG 118 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 101 PRPIMVRPWVPMRGQVPG 118 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 101 PRPIMVRPWVPMRGQVPG 118 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 101 PRPIMVRPWVPMRGQVPG 118 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 101 PRPIMVRPWVPMRGQVPG 118 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 101 PRPIMVRPWVPMRGQVPG 118 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 350 PRPIMVRPWVPMRGQVPG 367 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 350 PRPIMVRPWVPMRGQVPG 367 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 350 PRPIMVRPWVPMRGQVPG 367 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 350 PRPIMVRPWVPMRGQVPG 367 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 350 PRPIMVRPWVPMRGQVPG 367 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 350 PRPIMVRPWVPMRGQVPG 367 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 349 PRPIMVRPWVPMRGQVPG 366 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 334 PRPIMVRPWVPMRGQVPG 351 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 528 PCPVTTPPWWAVCGPVPG 475 P P+ PW + G VPG Sbjct: 350 PRPIMVRPWVPMRGQVPG 367 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 8.8 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 510 PPWWAVCGPVPGHGGRCSSRDQAWSKSSASL 418 P + + C PVPG+ + SR SS SL Sbjct: 73 PAFSSSCDPVPGNLEQIGSRPLHPPASSTSL 103 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 244,434 Number of Sequences: 438 Number of extensions: 5501 Number of successful extensions: 30 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29146299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -