BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B05 (890 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F3.10c |oct1||mitochondrial intermediate peptidase Oct1 |Sc... 27 4.7 SPAC222.15 |meu13|SPAC821.01|Tat binding protein 1|Schizosacchar... 26 6.3 SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyce... 26 8.3 SPBC30D10.07c |||biotin-protein ligase |Schizosaccharomyces pomb... 26 8.3 >SPAC1F3.10c |oct1||mitochondrial intermediate peptidase Oct1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 762 Score = 26.6 bits (56), Expect = 4.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 436 LGRALDVLPRLFQSLLGLAVRVSERXPGDSW 344 +G + L RLF SL GL ++ PG+ W Sbjct: 410 VGTVIQGLSRLFSSLYGLRFVPADISPGEVW 440 >SPAC222.15 |meu13|SPAC821.01|Tat binding protein 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 216 Score = 26.2 bits (55), Expect = 6.3 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +3 Query: 456 LNVEKNATALREKLQAAVQNTVQESQKLAKKVSSNVQETNEKLAPKIKAAYDDFAK 623 LN + +REK+Q+ + + S KL + V++ +++ K Y DFAK Sbjct: 120 LNNSLSPAEIREKIQSIDKEIEETSSKLESLRNGTVKQISKEAMQKTDKNY-DFAK 174 >SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyces pombe|chr 2|||Manual Length = 512 Score = 25.8 bits (54), Expect = 8.3 Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = +3 Query: 546 KVSSNVQET--NEKLAPKIKAAYD 611 +V N++ET EK A K+KA+YD Sbjct: 299 EVDLNIEETVLKEKYADKVKASYD 322 >SPBC30D10.07c |||biotin-protein ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 631 Score = 25.8 bits (54), Expect = 8.3 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -1 Query: 413 ASTVPKPPWPCRSRLRALPWRLLAKALSCCSTDSEPSFQAL 291 AST+ K PWP + L +P + + CS+ +E ++ + Sbjct: 38 ASTLEKEPWPASTALLVMPG---GRDMGYCSSFNETIYRKI 75 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,442,749 Number of Sequences: 5004 Number of extensions: 37487 Number of successful extensions: 129 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 448490560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -