BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B05 (890 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48600.1 68418.m06011 structural maintenance of chromosomes (... 31 1.4 At2g48160.1 68415.m06031 PWWP domain-containing protein 30 2.4 At1g70920.1 68414.m08183 homeobox-leucine zipper protein, putati... 29 4.1 At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)... 28 7.2 At4g28020.1 68417.m04019 expressed protein contains Pfam PF01980... 28 9.6 At2g01220.2 68415.m00035 expressed protein 28 9.6 At2g01220.1 68415.m00034 expressed protein 28 9.6 At1g23560.1 68414.m02964 expressed protein contains Pfam profile... 28 9.6 >At5g48600.1 68418.m06011 structural maintenance of chromosomes (SMC) family protein similar to SP|P50532 Chromosome assembly protein XCAP-C {Xenopus laevis}; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1241 Score = 30.7 bits (66), Expect = 1.4 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 4/76 (5%) Frame = +3 Query: 459 NVEKNATALREKLQAAVQNTVQESQKLAKKVSSNVQETNEKLAPKIKAAYDDFAKNTQEV 638 N+EK + L++KLQ ++N E K K +Q +K +I N Q++ Sbjct: 817 NLEKGSKQLKDKLQTNIENAGGEKLKGQKAKVEKIQTDIDKNNTEINRCNVQIETN-QKL 875 Query: 639 IKK----IQEAANAKQ 674 IKK I+EA K+ Sbjct: 876 IKKLTKGIEEATREKE 891 >At2g48160.1 68415.m06031 PWWP domain-containing protein Length = 1366 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +2 Query: 71 PVRISSALSLSTVHH-GRQVR--SSLRLHRSGPRSDGATRRSRLLQGHRTPHQGVP 229 P+R++ LS ST+H+ G + S ++L S P++DG+ + R H PH P Sbjct: 1184 PLRMNPPLSGSTMHYQGPESSYISGVQLTNSIPQADGSNFQHRPYPSHPHPHPPPP 1239 >At1g70920.1 68414.m08183 homeobox-leucine zipper protein, putative / HD-ZIP transcription factor, putative similar to homeodomain leucine zipper protein GI:5006851 from [Oryza sativa] Length = 206 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 626 HPGGDQEDPGGRQRQAVSVDIELSHLIHISFI 721 H D + GGR+R+ + + E SHL+ SFI Sbjct: 55 HVNEDDSNSGGRRRKKLRLTKEQSHLLEESFI 86 >At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3) Similar to Arabidopsis luminal binding protein (gb|D89342); contains Pfam domain PF00012: dnaK protein Length = 678 Score = 28.3 bits (60), Expect = 7.2 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Frame = +3 Query: 462 VEKNATALREKLQAAVQN---TVQESQKLAKKVSSNVQETNEKLAPKIKAAYDDFAKN 626 + K R KL+ V N TV + +KLAKK+S E EK+ +K A + +N Sbjct: 576 IMKEKIDARNKLETYVYNMKSTVADKEKLAKKIS---DEDKEKMEGVLKEALEWLEEN 630 >At4g28020.1 68417.m04019 expressed protein contains Pfam PF01980: Uncharacterised protein family Length = 351 Score = 27.9 bits (59), Expect = 9.6 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +3 Query: 198 KDIEHHTKEFHKTLXTTV-*LAHQVKGRTGLQQGLEGRL 311 +D+E+ KEF K+L +T+ A + KGR QQ L L Sbjct: 38 EDLENRIKEFEKSLGSTLEKSASERKGRVKAQQALREAL 76 >At2g01220.2 68415.m00035 expressed protein Length = 388 Score = 27.9 bits (59), Expect = 9.6 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 485 EGGGVLLDVQGGPCGAPRPCARCSASTVPKPP 390 EG LL+V CG PC SA KPP Sbjct: 227 EGHLKLLEVAMSVCGGGYPCFEISAINADKPP 258 >At2g01220.1 68415.m00034 expressed protein Length = 387 Score = 27.9 bits (59), Expect = 9.6 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 485 EGGGVLLDVQGGPCGAPRPCARCSASTVPKPP 390 EG LL+V CG PC SA KPP Sbjct: 226 EGHLKLLEVAMSVCGGGYPCFEISAINADKPP 257 >At1g23560.1 68414.m02964 expressed protein contains Pfam profile PF02713: Domain of unknown function DUF220 Length = 332 Score = 27.9 bits (59), Expect = 9.6 Identities = 15/49 (30%), Positives = 29/49 (59%) Frame = +3 Query: 507 VQNTVQESQKLAKKVSSNVQETNEKLAPKIKAAYDDFAKNTQEVIKKIQ 653 + T+QE K K NV+E + K KI+ AY++ ++ +++ K++Q Sbjct: 34 MNQTIQEPLKAEFKRLRNVKELSLKSVSKIETAYEEH-RDEEKLEKQLQ 81 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,250,365 Number of Sequences: 28952 Number of extensions: 215031 Number of successful extensions: 878 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 878 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2090971320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -