BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B04 (900 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 5.7 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 22 7.5 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 5.7 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +3 Query: 459 SXPIHESVPPQHHGNP 506 S + + +PP H+G P Sbjct: 53 SVGLRQGIPPHHYGGP 68 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.8 bits (44), Expect = 7.5 Identities = 11/32 (34%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 186 EHG--MGAPGGXXXAQLMAVYIAXYCVENVVD 275 EHG + PG Q + YC EN+ D Sbjct: 40 EHGHCVNLPGVGHRCQCQPGFTGKYCHENIND 71 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,215 Number of Sequences: 336 Number of extensions: 2118 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25030786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -