BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B04 (900 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1197 + 25199614-25199795,25200241-25200308,25200309-252004... 29 6.7 >08_02_1197 + 25199614-25199795,25200241-25200308,25200309-25200400, 25200940-25201019,25201418-25201535,25202371-25202562 Length = 243 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 111 AMLXAAFKPXVALVLNNWXALQLAVEHGMGAPGGXXXAQLMA 236 A AA + LV W ALQ+AVE+ G A +A Sbjct: 14 AQAAAALGEGIGLVFGRWTALQMAVENQWGGRDSRAKADQLA 55 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,402,279 Number of Sequences: 37544 Number of extensions: 188007 Number of successful extensions: 292 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2542098580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -