BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B03 (986 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 38 0.008 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 33 0.29 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 33 0.39 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 33 0.39 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 32 0.51 At1g61080.1 68414.m06877 proline-rich family protein 32 0.51 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 32 0.67 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 32 0.67 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 31 0.89 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 31 0.89 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 27 1.5 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 31 1.6 At4g18570.1 68417.m02749 proline-rich family protein common fami... 31 1.6 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 31 1.6 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 30 2.7 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 30 2.7 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 30 2.7 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 29 3.6 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 27 4.2 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 29 4.8 At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) i... 29 4.8 At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) i... 29 4.8 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 29 4.8 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 29 6.3 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 29 6.3 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 29 6.3 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 29 6.3 At4g33660.1 68417.m04781 expressed protein 25 7.4 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 28 8.3 At1g70990.1 68414.m08190 proline-rich family protein 28 8.3 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 28 8.3 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 38.3 bits (85), Expect = 0.008 Identities = 31/148 (20%), Positives = 34/148 (22%) Frame = -3 Query: 951 PXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGKXXXTXXXR 772 P P P PPPP P P PPP P Sbjct: 497 PPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPE 556 Query: 771 *XGRXEXQXKHXKEPXQGENXXDXXXPXGFPHLRPDPXIFXXNLRXPXPXXKPXPXXXXX 592 H P P +P+L P P + P P P P Sbjct: 557 PYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCI 616 Query: 591 XXXXXXXPFXQXXFPPLPPXXPXSPXPP 508 PP P SP PP Sbjct: 617 EPPPPPPCIEYSPPPPPPVVHYSSPPPP 644 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = -3 Query: 951 PXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P P PPPP + P P PPPPPP Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Score = 32.7 bits (71), Expect = 0.39 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -3 Query: 951 PXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P P PPPP P P PPPPPP Sbjct: 427 PPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPP 475 Score = 32.3 bits (70), Expect = 0.51 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -3 Query: 951 PXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P P PPPP P P PPPPPP Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP 476 Score = 31.9 bits (69), Expect = 0.67 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -3 Query: 951 PXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P P PPPP P P PPPPPP Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP 504 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = -3 Query: 918 PXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P PPPP P P PPPPPP Sbjct: 470 PPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = -3 Query: 918 PXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P PPPP P P PPPPPP Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = -3 Query: 951 PXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P P PPPP P P PPP PP Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP 488 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = -3 Query: 918 PXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P PPPP P P PPPPPP Sbjct: 421 PTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPP 458 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = -3 Query: 951 PXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P P PPPP P P PP PPP Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPP 489 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGK 796 PPPP A P P PPPPPP K Sbjct: 247 PPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLKK 282 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = -3 Query: 918 PXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P PPPP Q+ P K PPPPP Sbjct: 241 PTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPP 278 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 32.7 bits (71), Expect = 0.39 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGK 796 PPPP + P P + K PPPPP K Sbjct: 194 PPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSK 229 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = -3 Query: 918 PXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P PPPP P + P + PPPP P Sbjct: 147 PVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRP 184 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 32.7 bits (71), Expect = 0.39 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGK 796 PPPP Q+ P P K PPPPP K Sbjct: 240 PPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPPVK 275 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 32.3 bits (70), Expect = 0.51 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = -3 Query: 951 PXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P P PPPP P P PPPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 31.9 bits (69), Expect = 0.67 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -3 Query: 933 PXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P PPPP P P PPPPPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 28.3 bits (60), Expect = 8.3 Identities = 13/43 (30%), Positives = 13/43 (30%) Frame = -3 Query: 933 PXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P PPPP P P PPP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 32.3 bits (70), Expect = 0.51 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 PPPP A P P + PPPPPP Sbjct: 537 PPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 PPPP A P P PPPPPP Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXG 799 PPPP A P PPPPPP G Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPG 557 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 PPPP P P PPPPPP Sbjct: 563 PPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPP 595 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXG 799 PPPP A P P PPPPPP G Sbjct: 512 PPPPLPTTIAAPPPPPPPPRAA--VAPPPPPPPPG 544 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 31.9 bits (69), Expect = 0.67 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -3 Query: 951 PXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPP 808 P P P PPPP A P P PPPPP Sbjct: 115 PPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 31.9 bits (69), Expect = 0.67 Identities = 29/132 (21%), Positives = 33/132 (25%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGKXXXTXXXR*XGRXEXQXKHXKEPX 724 PPP P K P PPPPPP K P Sbjct: 142 PPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPP 201 Query: 723 QGENXXDXXXPXGFPHLRPDPXIFXXNLRXPXPXXKPXPXXXXXXXXXXXXPFXQXXFPP 544 P + + P P + + P P P P PP Sbjct: 202 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 261 Query: 543 LPPXXPXSPXPP 508 PP SP PP Sbjct: 262 PPPYVYSSPPPP 273 Score = 28.7 bits (61), Expect = 6.3 Identities = 28/132 (21%), Positives = 32/132 (24%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGKXXXTXXXR*XGRXEXQXKHXKEPX 724 PPP P K P PPPPP K P Sbjct: 182 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 241 Query: 723 QGENXXDXXXPXGFPHLRPDPXIFXXNLRXPXPXXKPXPXXXXXXXXXXXXPFXQXXFPP 544 P + + P P + + P P P P PP Sbjct: 242 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPP 301 Query: 543 LPPXXPXSPXPP 508 PP SP PP Sbjct: 302 PPPYVYSSPPPP 313 Score = 28.7 bits (61), Expect = 6.3 Identities = 28/132 (21%), Positives = 32/132 (24%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGKXXXTXXXR*XGRXEXQXKHXKEPX 724 PPP P K P PPPPP K P Sbjct: 202 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 261 Query: 723 QGENXXDXXXPXGFPHLRPDPXIFXXNLRXPXPXXKPXPXXXXXXXXXXXXPFXQXXFPP 544 P + + P P + + P P P P PP Sbjct: 262 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPP 321 Query: 543 LPPXXPXSPXPP 508 PP SP PP Sbjct: 322 PPPYVYTSPPPP 333 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 PPPP + P P + PPPPPP Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPP 48 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 PPPP + P P + PPPPPP Sbjct: 31 PPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPP 63 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 PPPP +A P + PPPPPP Sbjct: 17 PPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPP 49 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 31.5 bits (68), Expect = 0.89 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = -3 Query: 951 PXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGK 796 P P P PPP + P K PPPPPP K Sbjct: 378 PANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSK 429 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 26.6 bits (56), Expect(2) = 1.5 Identities = 11/33 (33%), Positives = 11/33 (33%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 PPPP P PPPPPP Sbjct: 298 PPPPLTSPQTPSPTVSTFNTKSSLRSQPPPPPP 330 Score = 22.6 bits (46), Expect(2) = 1.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -3 Query: 822 PPPPPPXGK 796 PPPPPP K Sbjct: 339 PPPPPPMSK 347 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/43 (30%), Positives = 14/43 (32%) Frame = -3 Query: 933 PXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P PPP + P P PPPPPP Sbjct: 522 PVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPP 564 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 933 PXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P K PPPP Q P P K PPPPPP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPP---PSVSKAPPPPPPPPP 342 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 30.7 bits (66), Expect = 1.6 Identities = 28/132 (21%), Positives = 31/132 (23%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGKXXXTXXXR*XGRXEXQXKHXKEPX 724 PPP P K P PPPPP K P Sbjct: 252 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 311 Query: 723 QGENXXDXXXPXGFPHLRPDPXIFXXNLRXPXPXXKPXPXXXXXXXXXXXXPFXQXXFPP 544 P + + P P + N P P P PP Sbjct: 312 PPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPP 371 Query: 543 LPPXXPXSPXPP 508 PP SP PP Sbjct: 372 PPPYVYSSPPPP 383 Score = 30.3 bits (65), Expect = 2.1 Identities = 29/132 (21%), Positives = 32/132 (24%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGKXXXTXXXR*XGRXEXQXKHXKEPX 724 PPP P K P PPPPP K P Sbjct: 52 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPP 111 Query: 723 QGENXXDXXXPXGFPHLRPDPXIFXXNLRXPXPXXKPXPXXXXXXXXXXXXPFXQXXFPP 544 P + + P P + N P P P P PP Sbjct: 112 PPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 171 Query: 543 LPPXXPXSPXPP 508 PP SP PP Sbjct: 172 PPPYVYSSPPPP 183 Score = 29.1 bits (62), Expect = 4.8 Identities = 28/132 (21%), Positives = 33/132 (25%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGKXXXTXXXR*XGRXEXQXKHXKEPX 724 PPP P K P PPPPP K P Sbjct: 272 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 331 Query: 723 QGENXXDXXXPXGFPHLRPDPXIFXXNLRXPXPXXKPXPXXXXXXXXXXXXPFXQXXFPP 544 + P + + P P + + P P P P PP Sbjct: 332 PPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPP 391 Query: 543 LPPXXPXSPXPP 508 PP SP PP Sbjct: 392 PPPYVYSSPPPP 403 Score = 29.1 bits (62), Expect = 4.8 Identities = 28/132 (21%), Positives = 32/132 (24%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGKXXXTXXXR*XGRXEXQXKHXKEPX 724 PPP P K P PPPPP K P Sbjct: 312 PPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPP 371 Query: 723 QGENXXDXXXPXGFPHLRPDPXIFXXNLRXPXPXXKPXPXXXXXXXXXXXXPFXQXXFPP 544 P + + P P + + P P P P PP Sbjct: 372 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 431 Query: 543 LPPXXPXSPXPP 508 PP SP PP Sbjct: 432 PPPYVYSSPPPP 443 Score = 28.7 bits (61), Expect = 6.3 Identities = 28/132 (21%), Positives = 32/132 (24%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGKXXXTXXXR*XGRXEXQXKHXKEPX 724 PPP P K P PPPPP K P Sbjct: 152 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 211 Query: 723 QGENXXDXXXPXGFPHLRPDPXIFXXNLRXPXPXXKPXPXXXXXXXXXXXXPFXQXXFPP 544 P + + P P + + P P P P PP Sbjct: 212 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 271 Query: 543 LPPXXPXSPXPP 508 PP SP PP Sbjct: 272 PPPYVYSSPPPP 283 Score = 28.7 bits (61), Expect = 6.3 Identities = 28/132 (21%), Positives = 32/132 (24%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGKXXXTXXXR*XGRXEXQXKHXKEPX 724 PPP P K P PPPPP K P Sbjct: 292 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPP 351 Query: 723 QGENXXDXXXPXGFPHLRPDPXIFXXNLRXPXPXXKPXPXXXXXXXXXXXXPFXQXXFPP 544 P + + P P + + P P P P PP Sbjct: 352 PPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPP 411 Query: 543 LPPXXPXSPXPP 508 PP SP PP Sbjct: 412 PPPYVYSSPPPP 423 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = -3 Query: 927 GXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 G P PPPP + P P + PPPPP Sbjct: 19 GRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPP 59 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 PPPP +A P + PPPPPP Sbjct: 28 PPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = -3 Query: 918 PXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPP 808 P PPPP P P + PPPPP Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/59 (23%), Positives = 18/59 (30%) Frame = -3 Query: 981 PXXXXKXKXXPXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P + P P + PPPP + P P + P PPPP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPP 73 Score = 28.3 bits (60), Expect = 8.3 Identities = 13/49 (26%), Positives = 15/49 (30%) Frame = -3 Query: 951 PXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P + PPPP P + PPPPPP Sbjct: 27 PPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPP 75 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = -3 Query: 918 PXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P PPPP P K PPPPPP Sbjct: 543 PSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPP 580 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = -3 Query: 933 PXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P PPPP P + P + PPPPPP Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPPPLAQPP----PPRPPPPPPP 605 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPP 808 PPPP ++ P P + PPPPP Sbjct: 576 PPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = -3 Query: 918 PXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPPXGK 796 P P PP P K PPPPPP G+ Sbjct: 732 PLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPPAGR 772 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/38 (31%), Positives = 13/38 (34%) Frame = -3 Query: 918 PXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P PPPP P + PPPPPP Sbjct: 589 PPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 PPPP P P PPPPPP Sbjct: 495 PPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPP 527 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = -3 Query: 951 PXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P P PPPP P P P PPPP Sbjct: 1076 PPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPP 1124 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 26.6 bits (56), Expect(2) = 4.2 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 69 SXPPPPXPPXXPP 107 S PPPP PP PP Sbjct: 61 SLPPPPPPPHLPP 73 Score = 21.0 bits (42), Expect(2) = 4.2 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +3 Query: 48 FXLSXVVSXPPPPXPP 95 F L PPPP PP Sbjct: 39 FFLPHPPPPPPPPPPP 54 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = -3 Query: 918 PXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P PPPP A P K + PPPPP Sbjct: 49 PPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPPP 86 >At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 680 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +3 Query: 3 QVFFLSCLSLXGALPFXLSXVVSXPPPPXPPXXPP 107 ++++ SC + PF + PP P PP PP Sbjct: 230 RLYWPSCTARYELYPFYNESAIETPPLPPPPPPPP 264 >At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 674 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +3 Query: 3 QVFFLSCLSLXGALPFXLSXVVSXPPPPXPPXXPP 107 ++++ SC + PF + PP P PP PP Sbjct: 230 RLYWPSCTARYELYPFYNESAIETPPLPPPPPPPP 264 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPP 808 PPPP P + P + + PPPPP Sbjct: 204 PPPPHIGNNPNMPPHIQPPNMNQNYRGPPPPP 235 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 28.7 bits (61), Expect = 6.3 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKX-----PPPPPPXGK 796 PPPP ++ P P K + PPPPPP K Sbjct: 123 PPPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPPPPPSK 163 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = -3 Query: 918 PXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPP 808 P PPPP P P PPPPP Sbjct: 496 PPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -3 Query: 903 PPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 PPPP Q+ P P + PPPPPP Sbjct: 607 PPPPTYYATQSPPPPP--PPTYYAVQSPPPPPP 637 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 28.7 bits (61), Expect = 6.3 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 960 KXXPXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 K P P P PPPP A P P K PPPPP Sbjct: 50 KCSPSCIQNPPPPSPPPPSPPPPACPPPPALPP----PPPKKVSSYCPPPPP 97 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 25.4 bits (53), Expect(2) = 7.4 Identities = 12/38 (31%), Positives = 12/38 (31%) Frame = -3 Query: 918 PXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P P P Q P P PPPPPP Sbjct: 4 PKYAYPYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPP 41 Score = 21.8 bits (44), Expect(2) = 7.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -3 Query: 822 PPPPPPXGK 796 PPPPPP K Sbjct: 38 PPPPPPPRK 46 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 13 SFLASPXSGHFLSXFXXLFPXPPPXXPPXXP 105 SF + P HF P PPP PP P Sbjct: 30 SFRSIPPRRHFFKKKSKSLPPPPPPLPPARP 60 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = -3 Query: 966 KXKXXPXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPP 811 K + P K P PPP QA P P K PPPP Sbjct: 76 KLEEDPIKCTPCLQNIPPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/59 (23%), Positives = 18/59 (30%) Frame = -3 Query: 981 PXXXXKXKXXPXKXXXPXGXKPXXXXPPPPXXXXXQAXPXXXKXPXXXKXXKXPPPPPP 805 P + + P P P P PP + P P + PPP PP Sbjct: 48 PSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,881,671 Number of Sequences: 28952 Number of extensions: 165723 Number of successful extensions: 3836 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2923 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2402185656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -