BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B02 (909 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC330.08 |alg11|gmd3|alpha-1,2-mannosyltransferase Alg11|Schiz... 28 2.1 >SPCC330.08 |alg11|gmd3|alpha-1,2-mannosyltransferase Alg11|Schizosaccharomyces pombe|chr 3|||Manual Length = 471 Score = 27.9 bits (59), Expect = 2.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 397 QKIYHFFPDFFIPXLGKWTFLSCLRLGFTEVP 302 + IY F PD FI +G + F C+ F +P Sbjct: 154 EAIYRFAPDIFIDTMG-YAFTFCVVKSFQNIP 184 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,028,323 Number of Sequences: 5004 Number of extensions: 32681 Number of successful extensions: 66 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 460503700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -