BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B02 (909 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74027-2|CAA98420.1| 210|Caenorhabditis elegans Hypothetical pr... 30 2.6 AF324058-1|AAK01419.1| 210|Caenorhabditis elegans Ly-6-related ... 30 2.6 AF068709-6|AAC19249.1| 319|Caenorhabditis elegans Serpentine re... 28 8.0 >Z74027-2|CAA98420.1| 210|Caenorhabditis elegans Hypothetical protein C13G3.2 protein. Length = 210 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 509 RILLTYFNMISFEYVICICKNVYYNIFQFVKI 604 R L Y N +S +YV+C C Y N + ++ Sbjct: 126 RSLPMYSNTVSMDYVVCTCNGDYCNTMEMPEV 157 >AF324058-1|AAK01419.1| 210|Caenorhabditis elegans Ly-6-related protein HOT-6 protein. Length = 210 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 509 RILLTYFNMISFEYVICICKNVYYNIFQFVKI 604 R L Y N +S +YV+C C Y N + ++ Sbjct: 126 RSLPMYSNTVSMDYVVCTCNGDYCNTMEMPEV 157 >AF068709-6|AAC19249.1| 319|Caenorhabditis elegans Serpentine receptor, class t protein27 protein. Length = 319 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 434 YFISSLAV*YNMYIVVFAETRFFQARILLTYFNMISF 544 Y + +L V Y MY V+F F ++ L +FN + F Sbjct: 153 YGVLTLPVIYGMYFVIFTTPIAFSSKHLTWFFNPLIF 189 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,238,855 Number of Sequences: 27780 Number of extensions: 188167 Number of successful extensions: 466 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 466 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2318293978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -