BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_B01 (933 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6UUU1 Cluster: Putative uncharacterized protein; n=1; ... 47 6e-04 UniRef50_Q9KHC4 Cluster: SocE; n=1; Myxococcus xanthus|Rep: SocE... 46 0.002 >UniRef50_Q6UUU1 Cluster: Putative uncharacterized protein; n=1; Escherichia coli|Rep: Putative uncharacterized protein - Escherichia coli Length = 147 Score = 47.2 bits (107), Expect = 6e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 487 VCVLGXLPLPRSLTXCARSFGCGXRYXLT 573 +C G +PLPRSLT ARSFGCG RY LT Sbjct: 30 ICDTGDIPLPRSLTRYARSFGCGERYRLT 58 >UniRef50_Q9KHC4 Cluster: SocE; n=1; Myxococcus xanthus|Rep: SocE - Myxococcus xanthus Length = 486 Score = 45.6 bits (103), Expect = 0.002 Identities = 27/57 (47%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +1 Query: 451 CXNXSANXRGXAVCVLGXLPLPRSLTXCARSFGCGXRYXL-TQRR*YGYPQNQGIPQ 618 C A R AV VL LPL RS T C RS GCG + R YG PQ QG+ Q Sbjct: 266 CIRDPATARSEAVWVLVALPLLRSRTRCVRSVGCGGAVSAHSPGRPYGDPQPQGMAQ 322 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 471,340,815 Number of Sequences: 1657284 Number of extensions: 5268745 Number of successful extensions: 6943 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6671 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6927 length of database: 575,637,011 effective HSP length: 101 effective length of database: 408,251,327 effective search space used: 85324527343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -