BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_A19 (893 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0507 + 3655570-3655573,3655648-3655832 76 3e-14 04_04_0165 + 23247265-23247472,23248115-23248407,23249182-232492... 29 5.0 >06_01_0507 + 3655570-3655573,3655648-3655832 Length = 62 Score = 76.2 bits (179), Expect = 3e-14 Identities = 36/59 (61%), Positives = 42/59 (71%) Frame = +3 Query: 291 GKVXGSLARAGKVKGXTPKVEXXXXXXXXXGRAKRRIQYNRRFVNVVQTFGRRRGPNSN 467 GKV GSLARAGKV+G TPKV GRA +R+QYNRRFV V FG++RGPNS+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSS 60 >04_04_0165 + 23247265-23247472,23248115-23248407,23249182-23249239, 23249302-23250014 Length = 423 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 131 PGVXWSXQGTHSYSCCSWRXXPYSIIMW 214 PG+ W+ Q YS CS P I MW Sbjct: 378 PGIHWNNQWMRGYSDCSHWCLPGPIDMW 405 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,625,029 Number of Sequences: 37544 Number of extensions: 110621 Number of successful extensions: 183 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2518669100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -