BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_A18 (897 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein ... 124 5e-30 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 24 7.2 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 24 7.2 >AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein S17 protein. Length = 131 Score = 124 bits (298), Expect = 5e-30 Identities = 68/111 (61%), Positives = 75/111 (67%) Frame = +1 Query: 139 IEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQXR 318 IEKYYTRLT+DFDTNKRI EE+AIIPTKPLRNKIAGF THLM+RLRHSQVRGISIKLQ Sbjct: 17 IEKYYTRLTMDFDTNKRIVEEVAIIPTKPLRNKIAGFVTHLMKRLRHSQVRGISIKLQEE 76 Query: 319 GA*EA*XLCPRSVCSRXMTSSK*TPNTXDMLXMLDFTNINGLQLTQXATXG 471 P V + + P T +ML LDF NI +QLT G Sbjct: 77 ERERRDNYVP-DVSALEQDIIEVDPETKEMLKHLDFNNI-VVQLTNPTAPG 125 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.8 bits (49), Expect = 7.2 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 816 LXGAPPPXXPPPKXPXXP 869 L A PP PPP P P Sbjct: 576 LPNAQPPPAPPPPPPMGP 593 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.8 bits (49), Expect = 7.2 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 822 GAPPPXXPPPKXPXXP 869 G+PPP PPP P Sbjct: 781 GSPPPPPPPPPSSLSP 796 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 687,862 Number of Sequences: 2352 Number of extensions: 12479 Number of successful extensions: 38 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96747534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -