BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_A17 (905 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92834-4|CAB07387.1| 117|Caenorhabditis elegans Hypothetical pr... 104 1e-22 Z69634-3|CAA93454.4| 553|Caenorhabditis elegans Hypothetical pr... 28 8.0 >Z92834-4|CAB07387.1| 117|Caenorhabditis elegans Hypothetical protein F39B2.6 protein. Length = 117 Score = 104 bits (249), Expect = 1e-22 Identities = 47/81 (58%), Positives = 53/81 (65%) Frame = +3 Query: 150 VKAVXCTNCARCVPKXKAIKKFXXXXXXXXXXXXXINDASVYPMFQLPKLYAKLHYCVSC 329 V + CTNC RC PK KAIKKF I DAS Y + LPKLY KLHYC++C Sbjct: 18 VAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALPKLYHKLHYCIAC 77 Query: 330 AIHSKVVRNRSKKDRRIRTPP 392 AIHSKVVRNRS++ RR R PP Sbjct: 78 AIHSKVVRNRSREARRDRNPP 98 >Z69634-3|CAA93454.4| 553|Caenorhabditis elegans Hypothetical protein B0001.5 protein. Length = 553 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +2 Query: 314 LLRVMRHPQQSCQEQIEERQKNPYSSQE*LP*GHVTSTGSAK 439 ++ V + P +S ++ + QKN Y+S E GH TS+ +A+ Sbjct: 374 VINVYKEPSRSHANELYDSQKNQYTSHE----GHSTSSPTAE 411 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,259,823 Number of Sequences: 27780 Number of extensions: 205026 Number of successful extensions: 347 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 347 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2307803960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -