BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_A14 (896 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0513 - 16681227-16683936,16685572-16685966 29 3.8 09_03_0156 - 12844549-12845138,12845237-12845723 29 5.0 11_04_0051 + 12863978-12864476,12864575-12864674,12865567-128656... 29 6.6 >04_03_0513 - 16681227-16683936,16685572-16685966 Length = 1034 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +2 Query: 263 QQGLLHKHESLRKFHDDVQGRIPSQEFGILDLL 361 Q G+LH+ ESL +D+ G IP QE LD L Sbjct: 905 QLGMLHQLESLDLSSNDLSGEIP-QELASLDFL 936 >09_03_0156 - 12844549-12845138,12845237-12845723 Length = 358 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +2 Query: 656 YQRKRTFVMYANYSNSLTYPNNEDRIAYLTEDVGLNAYYYYFHSHLPFWWTLVNT 820 Y+R F+ N LTY E+ A LTE+ L Y Y+ P +++ T Sbjct: 71 YRRNAEFIDAVNLRGDLTYQLAENEFADLTEEEFLATYTGYYAGDGPVDDSVITT 125 >11_04_0051 + 12863978-12864476,12864575-12864674,12865567-12865657, 12866114-12866176,12866364-12866549,12866994-12867024, 12867054-12867502 Length = 472 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +2 Query: 656 YQRKRTFVMYANYSNSLTYPNNEDRIAYLTEDVGLNAYYYYF 781 Y+R F+ N LTY E+ A LTE+ L Y Y+ Sbjct: 75 YRRNAEFIDAVNLRGDLTYQLAENEFADLTEEEFLATYTGYY 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,840,516 Number of Sequences: 37544 Number of extensions: 373635 Number of successful extensions: 912 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 912 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2530383840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -