BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_A10 (901 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1500 + 34010819-34011016,34013267-34013308,34014195-340142... 29 6.7 >04_04_1500 + 34010819-34011016,34013267-34013308,34014195-34014204, 34014526-34014586,34014621-34014678,34015266-34015412, 34015643-34016205,34018942-34019728 Length = 621 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +2 Query: 239 NQKTKKCEEFIYGGCQGNDNRFITLAECEQK 331 N KTK CE F+ G C D E EQ+ Sbjct: 587 NYKTKLCENFVKGTCTFGDRCHFAHGENEQR 617 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,232,840 Number of Sequences: 37544 Number of extensions: 289525 Number of successful extensions: 520 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2542098580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -